Align anthranilate synthase (subunit 1/2) (EC 4.1.3.27) (characterized)
to candidate WP_012992587.1 THAL_RS07900 anthranilate synthase component I
Query= BRENDA::P20580 (492 letters) >NCBI__GCF_000025605.1:WP_012992587.1 Length = 487 Score = 402 bits (1032), Expect = e-116 Identities = 226/480 (47%), Positives = 311/480 (64%), Gaps = 18/480 (3%) Query: 14 YNRIPLSFETLADFDTPLSIYLKLA-DAPNSYLLESVQGGEKWGRYSIIGLPCRTVLRVY 72 Y + L E LAD +TPLS++LKL + + LLES +GG +WGRYS I ++ Sbjct: 17 YRPVALYTEVLADTETPLSLFLKLRKEGAFNILLESAEGGSQWGRYSFIIRSESFYWKLL 76 Query: 73 DHQVRISIDG----VETERFDCADPLAFVEEFKARYQVPTVPGLPRFDGGLVGYFGYDCV 128 + + G V TE DP + + + +Q P LPRF GGLVGY YD V Sbjct: 77 RKRGEVFQRGRFREVVTE-----DPFGELNKVMSTFQPYRDPSLPRFWGGLVGYVSYDVV 131 Query: 129 RYVEKRLATCPNPDPLGNPDILLMVSDAVVVFDNLAGKIHAIVLADPSEENAYERGQARL 188 ++ E + DPL PDI+++++D VV+ DNL GK+ +V S Y RG+ + Sbjct: 132 KHYEPVRDSLD--DPLMLPDIMMVLTDLVVIHDNLTGKVKVVVPLFESSVEEYRRGERTI 189 Query: 189 EELLERLRQPITPRRGLDLEAAQGREPA-FRASFTREDYENAVGRIKDYILAGDCMQVVP 247 E+ L + R + + + +EP+ + ++ +++++ + V R K+YI AGD +QVV Sbjct: 190 EDTLHHIFH-----RSVLPSSFKEKEPSGWTSNTSQQEFIDMVTRAKEYIAAGDVIQVVL 244 Query: 248 SQRMSIEFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDGLVTVRPIA 307 SQR +K P ++YR LR NP+PYMY+ + G F V+GSSPEVLVRVED RPIA Sbjct: 245 SQRFYKSWKGDPQNIYRVLRYINPSPYMYYLDMGSFQVIGSSPEVLVRVEDKTAHTRPIA 304 Query: 308 GTRPRGINEEADLALEQDLLSDAKEIAEHLMLIDLGRNDVGRVSDIGAVKVTEKMVIERY 367 GTR RG EE D+ LE++L+ D KE AEHLML+DL RND+ RV G+VKV E M +ERY Sbjct: 305 GTRRRGRTEEEDVRLEEELVKDEKERAEHLMLVDLARNDLARVCVPGSVKVKEFMKVERY 364 Query: 368 SNVMHIVSNVTGQLREGLSAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKRGVYGGAV 427 S+VMH+VS+V G L EG+S D L+A+ PAGT+SGAPK+RAM+II+ELE +RG+Y G+V Sbjct: 365 SHVMHMVSHVDGILAEGVSPFDVLKAVFPAGTVSGAPKVRAMQIIEELEKERRGIYAGSV 424 Query: 428 GYLAWNGNMDTAIAIRTAVIKNGELHVQAGGGIVADSVPALEWEETINKRRAMFRAVALA 487 GY+++ GNMD AIAIRTAV + GE+ VQAG GIVADS P EW ET+NK +A+ +AV +A Sbjct: 425 GYVSFEGNMDMAIAIRTAVYRGGEIFVQAGAGIVADSDPYREWLETVNKAKAVMKAVDMA 484 Lambda K H 0.321 0.139 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 574 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 487 Length adjustment: 34 Effective length of query: 458 Effective length of database: 453 Effective search space: 207474 Effective search space used: 207474 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
Align candidate WP_012992587.1 THAL_RS07900 (anthranilate synthase component I)
to HMM TIGR00564 (trpE: anthranilate synthase component I (EC 4.1.3.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00564.hmm # target sequence database: /tmp/gapView.1099.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00564 [M=455] Accession: TIGR00564 Description: trpE_most: anthranilate synthase component I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-175 568.8 0.0 5.6e-175 568.6 0.0 1.0 1 lcl|NCBI__GCF_000025605.1:WP_012992587.1 THAL_RS07900 anthranilate syntha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025605.1:WP_012992587.1 THAL_RS07900 anthranilate synthase component I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 568.6 0.0 5.6e-175 5.6e-175 1 454 [. 28 481 .. 28 482 .. 0.96 Alignments for each domain: == domain 1 score: 568.6 bits; conditional E-value: 5.6e-175 TIGR00564 1 adtltpisvylklak.rkesfllEsvekeeelgRySliglnpvleikakdgkavlleaddeeakieede 68 adt+tp+s++lkl+k + ++llEs+e ++++gRyS+i ++ + +k ++ + ++ ++ ++ed+ lcl|NCBI__GCF_000025605.1:WP_012992587.1 28 ADTETPLSLFLKLRKeGAFNILLESAEGGSQWGRYSFIIRSESFYWKLLRKRGEVFQRGRFREVVTEDP 96 699***********966999***************************999988999988888889**** PP TIGR00564 69 lkelrklleka.eesedeldeplsggavGylgydtvrlveklkeeaedelelpdlllllvetvivfDhv 136 el+k+++++ ++++l+ + gg+vGy++yd+v+++e+++++ d+l lpd++++l++ v+++D+ lcl|NCBI__GCF_000025605.1:WP_012992587.1 97 FGELNKVMSTFqPYRDPSLPR-FWGGLVGYVSYDVVKHYEPVRDSLDDPLMLPDIMMVLTDLVVIHDNL 164 ***********7777788876.*********************************************** PP TIGR00564 137 ekkvilienarteaersaeeeaaarleellaelqkelekavkaleekkesftsnvekeeyeekvakake 205 + kv ++ ++ +++ ++ ++++e++l+++ + + +++e+++ tsn++++e+ + v++ake lcl|NCBI__GCF_000025605.1:WP_012992587.1 165 TGKVKVVVPLFES-SVEEYRRGERTIEDTLHHIFHRSVLPSSFKEKEPSGWTSNTSQQEFIDMVTRAKE 232 *******999555.55589999******9999988888778888888888******************* PP TIGR00564 206 yikaGdifqvvlSqrleakveakpfelYrkLRtvNPSpylyyldledfelvgsSPEllvkvkgkrvetr 274 yi+aGd++qvvlSqr+ ++ + +p ++Yr+LR +NPSpy+yyld+ f+++gsSPE+lv+v++k+ +tr lcl|NCBI__GCF_000025605.1:WP_012992587.1 233 YIAAGDVIQVVLSQRFYKSWKGDPQNIYRVLRYINPSPYMYYLDMGSFQVIGSSPEVLVRVEDKTAHTR 301 ********************************************************************* PP TIGR00564 275 PiAGtrkRGatkeeDealeeeLladeKerAEHlmLvDLaRNDigkvaklgsvevkellkiekyshvmHi 343 PiAGtr+RG+t+eeD +leeeL++deKerAEHlmLvDLaRND+++v+ +gsv+vke++k+e+yshvmH+ lcl|NCBI__GCF_000025605.1:WP_012992587.1 302 PIAGTRRRGRTEEEDVRLEEELVKDEKERAEHLMLVDLARNDLARVCVPGSVKVKEFMKVERYSHVMHM 370 ********************************************************************* PP TIGR00564 344 vSeVeGelkdeltavDalraalPaGTlsGAPKvrAmelidelEkekRgiYgGavgylsfdgdvdtaiai 412 vS+V G l+++++++D+l+a++PaGT+sGAPKvrAm++i+elEke+RgiY+G+vgy+sf+g++d+aiai lcl|NCBI__GCF_000025605.1:WP_012992587.1 371 VSHVDGILAEGVSPFDVLKAVFPAGTVSGAPKVRAMQIIEELEKERRGIYAGSVGYVSFEGNMDMAIAI 439 ********************************************************************* PP TIGR00564 413 RtmvlkdgvayvqAgaGiVaDSdpeaEyeEtlnKakallrai 454 Rt+v++ g ++vqAgaGiVaDSdp++E+ Et+nKaka+++a+ lcl|NCBI__GCF_000025605.1:WP_012992587.1 440 RTAVYRGGEIFVQAGAGIVADSDPYREWLETVNKAKAVMKAV 481 ***************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (455 nodes) Target sequences: 1 (487 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.86 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory