Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_013009358.1 DACET_RS00020 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q8YTF2 (403 letters) >NCBI__GCF_000025725.1:WP_013009358.1 Length = 409 Score = 233 bits (595), Expect = 6e-66 Identities = 123/319 (38%), Positives = 186/319 (58%), Gaps = 5/319 (1%) Query: 18 YVFARLDELKAKAREQGID--LIDLGMGNPDGATPQPVVDAAIQALQDPKNHGYPPFEGT 75 Y F ++ K A + D LID+G+G PD VV + + +N Y G Sbjct: 25 YKFEKIKRAKRAAIKDNPDMELIDMGVGEPDAMAHGDVVKVLQREAEKRENRFYSD-NGI 83 Query: 76 ASFRRAITNWYNRRYGVVLDPDSEALPLLGSKEGLSHLAIAYVNPGDVVLVPSPAYPAHF 135 F+ + R+GV LDP ++ +GSK L+ +A +NPGDV ++ P YP Sbjct: 84 DGFKSVSAEYMKTRFGVELDPSTQINHCIGSKPALALFPLALINPGDVAIMTVPGYPVSG 143 Query: 136 RGPVIAGGTVHSLILKPENDWLIDLTAIPEEVARKAKILYFNYPSNPTGATAPREFFEEI 195 GG V+++ L EN++L DL +IPE++ ++AK LY NYP+NPTG AP+EF+E++ Sbjct: 144 TTTKYLGGEVYNVKLLKENNFLPDLDSIPEDICKRAKFLYLNYPNNPTGVLAPKEFYEKV 203 Query: 196 VAFARKYEILLVHDLCYAELAFDGYQPTSLLEIPGAKDIGVEFHTLSKTYNMAGWRVGFV 255 VAFA+KY+I ++ D Y EL F QP S L + GA D+G+E H+LSK++NM GWR+GFV Sbjct: 204 VAFAKKYDIAVISDAAYIELTFGEKQP-SFLSVDGAMDVGIEIHSLSKSFNMTGWRIGFV 262 Query: 256 VGNRHVIQGLRTLKTNLDYGIFAALQTAAETALQLPDIYLHEVQQRYRTRRDFLIQGLGE 315 GN+H++Q T+K N D G F +Q AA L+ P++ + +++Y R + L L + Sbjct: 263 CGNKHLVQAFATVKDNNDSGQFIPIQKAACYCLEHPEL-IAPTKEKYGRRLNMLANVLRK 321 Query: 316 LGWDVPKTKATMYLWVKCP 334 G+ V + K + YL+ P Sbjct: 322 NGFSVEEPKGSFYLYFGIP 340 Lambda K H 0.321 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 397 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 409 Length adjustment: 31 Effective length of query: 372 Effective length of database: 378 Effective search space: 140616 Effective search space used: 140616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory