Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate WP_013011162.1 DACET_RS09500 glutamate 5-kinase
Query= BRENDA::P0A7B5 (367 letters) >NCBI__GCF_000025725.1:WP_013011162.1 Length = 380 Score = 282 bits (721), Expect = 1e-80 Identities = 159/366 (43%), Positives = 227/366 (62%), Gaps = 5/366 (1%) Query: 5 QTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPE 64 +TLVVK+G+++LT R +N + LVR IV+V+SGA+ AG + LG+ E Sbjct: 8 ETLVVKVGSNILTHHERGVNLEFLSGLVRILCNFKKNIPNIVVVSSGAVGAGFKLLGFSE 67 Query: 65 LPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDTLRAL 124 P I KQ AAVGQ+RLI +++ F YG+ Q+L+T+ D+ +R R+LNAR TLR L Sbjct: 68 RPQNITDKQACAAVGQARLIWEYDREFEKYGVTSAQILITKDDLSNRRRYLNARYTLRRL 127 Query: 125 LDNNIVPVINENDAVATAEIK----VGDNDNLSALAAILAGADKLLLLTDQKGLYTADPR 180 L+ +VPVINEND+V E++ DNDNLSAL + L GAD LL+L+D GL+ DP Sbjct: 128 LELGVVPVINENDSVVIEELRQIENFTDNDNLSALVSGLIGADMLLILSDVDGLFDKDPF 187 Query: 181 SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPG 240 N A+ I++V I++ L +AGDSVSG+GTGGM +KL+AA A AG I G Sbjct: 188 KNKDAKRIEEVKYINEELLNVAGDSVSGVGTGGMKSKLEAAGKALDAGCHVGIINGMNLF 247 Query: 241 VIGDVMEGISVGTLFHAQATPLENRKRWI-FGAPPAGEITVDEGATAAILERGSSLLPKG 299 + + G VGT F+ PL RK WI + A +GE+ VD GA A++ + +SLLP G Sbjct: 248 NVEAFLNGEDVGTFFNHIEDPLTRRKHWIAYAAGASGELHVDNGAVNALVNKKTSLLPSG 307 Query: 300 IKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAV 359 + VTG+F G+V+ + +G+++A G RY S+ I G S +I +ILGY++ + Sbjct: 308 VTKVTGHFGMGDVVAVIGPDGKEVARGKVRYASEDADLIKGKKSSDISSILGYKFTDEII 367 Query: 360 HRDDMI 365 HRDD++ Sbjct: 368 HRDDLV 373 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 380 Length adjustment: 30 Effective length of query: 337 Effective length of database: 350 Effective search space: 117950 Effective search space used: 117950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_013011162.1 DACET_RS09500 (glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.27608.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-133 430.8 0.2 2.5e-133 430.6 0.2 1.0 1 lcl|NCBI__GCF_000025725.1:WP_013011162.1 DACET_RS09500 glutamate 5-kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025725.1:WP_013011162.1 DACET_RS09500 glutamate 5-kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 430.6 0.2 2.5e-133 2.5e-133 2 362 .. 9 373 .. 8 374 .. 0.99 Alignments for each domain: == domain 1 score: 430.6 bits; conditional E-value: 2.5e-133 TIGR01027 2 riVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaekQa 70 ++VvK+Gs++Lt++++ ++++ l+ lv+ +++ kk+ ++v+vsSGav aG++ Lg++erp+++++kQa lcl|NCBI__GCF_000025725.1:WP_013011162.1 9 TLVVKVGSNILTHHERGVNLEFLSGLVRILCNFKKNIPNIVVVSSGAVGAGFKLLGFSERPQNITDKQA 77 89******************************************************************* PP TIGR01027 71 laaVGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvavee 139 aaVGQ+rL+ +y++ f++yg ++aQiL+t++dls+r+rylNar tl++llelgvvp++NEND+v +ee lcl|NCBI__GCF_000025725.1:WP_013011162.1 78 CAAVGQARLIWEYDREFEKYGVTSAQILITKDDLSNRRRYLNARYTLRRLLELGVVPVINENDSVVIEE 146 ********************************************************************* PP TIGR01027 140 i....kfGDNDtLsalvaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgss 204 + +f DND+Lsalv+ l++Ad+L++l+dvdgL+d+dp +n dAk+ieev+ i+eel +vag+s s lcl|NCBI__GCF_000025725.1:WP_013011162.1 147 LrqieNFTDNDNLSALVSGLIGADMLLILSDVDGLFDKDPFKNKDAKRIEEVKYINEELLNVAGDSVSG 215 955555*************************************************************** PP TIGR01027 205 vGTGGmrtKleaaelAsragveviiasgekpekiadlledaavgtlfeakkkklknrkqwilaaseakG 273 vGTGGm++Kleaa A +ag +v i++g + ++ ++l+++ vgt+f+ + l rk+wi++a+ a+G lcl|NCBI__GCF_000025725.1:WP_013011162.1 216 VGTGGMKSKLEAAGKALDAGCHVGIINGMNLFNVEAFLNGEDVGTFFNHIEDPLTRRKHWIAYAAGASG 284 ********************************************************************* PP TIGR01027 274 kiivdegaeeallekgksLlpagvvevegnFsrgevveilaeegqeigkglvnysseelekikglksee 342 ++ vd+ga++al++k++sLlp+gv++v+g+F g+vv + ++g+e+++g+v+y se+ ikg+ks++ lcl|NCBI__GCF_000025725.1:WP_013011162.1 285 ELHVDNGAVNALVNKKTSLLPSGVTKVTGHFGMGDVVAVIGPDGKEVARGKVRYASEDADLIKGKKSSD 353 ********************************************************************* PP TIGR01027 343 iedvLgyekkeevvhrdnlv 362 i+ +Lgy+ ++e++hrd+lv lcl|NCBI__GCF_000025725.1:WP_013011162.1 354 ISSILGYKFTDEIIHRDDLV 373 ******************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (380 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.44 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory