Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54); chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_013011671.1 DACET_RS12115 3-deoxy-8-phosphooctulonate synthase
Query= BRENDA::P39912 (358 letters) >NCBI__GCF_000025725.1:WP_013011671.1 Length = 256 Score = 108 bits (269), Expect = 2e-28 Identities = 78/253 (30%), Positives = 129/253 (50%), Gaps = 21/253 (8%) Query: 112 EKIGDGQQRFIVGPCAVESYEQVAEVAAAAKKQGIKILRGGAFKP------RTSPYDFQG 165 EKI G + GPC +E+ + ++A K ++ FK RTS ++G Sbjct: 4 EKIKSGMF-VMAGPCVIENESVIMQIAETVKTISEELKFTYIFKSSFDKANRTSISSYRG 62 Query: 166 LGV-EGLQILKRVADEFDLAVISEIVTPAHIEEALDYIDVIQIGARNMQNFELLKAAGAV 224 G+ EGL++L+++ D F L ++++I P + A + D++QI A + +LL AA Sbjct: 63 PGLDEGLRLLQKIKDTFQLPIVTDIHEPYQADAAAEVADILQIPAFLCRQTDLLVAAAKT 122 Query: 225 KKPVLLKRGLAATISEFINAAEYIMSQGNDQIILCERGIRTYETATRNTLDISAVPILKQ 284 K + +K+ ++ + + + GN QIIL ERG + R +D + + +K+ Sbjct: 123 GKIINIKKAQFLDGNDMLYPVQKVEQSGNKQIILTERG--SMFGPGRLVVDFTQIVDMKK 180 Query: 285 ETHLPVFVDVTHST----------GRRDLLLPTAKAALAIGADGVMAEVHPDPSVALSDS 334 + PV +DVTHST G+ + AKAA A+G DG EVHP+P ALSD Sbjct: 181 IGY-PVVMDVTHSTQRPGGGATSGGKPEYAPYIAKAAKAVGVDGFFFEVHPEPKEALSDG 239 Query: 335 AQQMAIPEFEKWL 347 + + + EF++ L Sbjct: 240 SNMVRLSEFKELL 252 Lambda K H 0.316 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 256 Length adjustment: 27 Effective length of query: 331 Effective length of database: 229 Effective search space: 75799 Effective search space used: 75799 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory