Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate WP_013012239.1 DACET_RS15155 imidazole glycerol phosphate synthase subunit HisF
Query= curated2:Q18DL2 (245 letters) >NCBI__GCF_000025725.1:WP_013012239.1 Length = 253 Score = 117 bits (294), Expect = 2e-31 Identities = 80/240 (33%), Positives = 128/240 (53%), Gaps = 12/240 (5%) Query: 10 VIPAVDMQDGDVVQLVQGERGTETR-YGDPVVAAKQWVEAGAKTLHLVDLDGAFEGDRMN 68 +IP +D++DG VV+ G R GDPV A+ + E GA L +D+ + + + Sbjct: 6 IIPCLDVKDGRVVK---GTNFVNLRDAGDPVEVAQIYDEQGADELTFLDITASSDNRGII 62 Query: 69 ATAVDAIIDAVDIPVQLGGGIRTANDAASLLDRGVNRVILGTAAVENPDLVAELAESYPG 128 V + V +PV +GGG+R +D +LL+ G ++V + TAAV NPD V E A + Sbjct: 63 LDVVAKTAERVFMPVTVGGGVREVSDIRNLLNSGADKVSINTAAVHNPDFVKESALKFGS 122 Query: 129 R-IIVSLDA---ADG---EVVVSGWTESTGIDPAVAAARFADYGACGILFTDVDVEGKLA 181 + +V++DA ADG EV G + TG+D A + +GA IL T +D +G Sbjct: 123 QCTVVAIDAKRKADGSGWEVYTHGGRKPTGLDAVEWALKMESFGAGEILLTSMDCDGTKD 182 Query: 182 GIQSSVTARVIDAVDIPVIASGGVASLDDIQTLHTTGAAATVVGTALYE-NKFTLADAME 240 G + + A + +A+ IPVIASGGV S + I T G A + +++ ++T+ + + Sbjct: 183 GYDNGLNAAISEALMIPVIASGGVGSPEHIYDGLTRGKADAALAASIFHFREYTIGEVKQ 242 Lambda K H 0.316 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 245 Length of database: 253 Length adjustment: 24 Effective length of query: 221 Effective length of database: 229 Effective search space: 50609 Effective search space used: 50609 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory