Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_013074689.1 BTUS_RS03205 homoserine O-acetyltransferase
Query= SwissProt::C4XNQ9 (397 letters) >NCBI__GCF_000092905.1:WP_013074689.1 Length = 373 Score = 350 bits (899), Expect = e-101 Identities = 178/357 (49%), Positives = 237/357 (66%), Gaps = 8/357 (2%) Query: 30 PLTVESGRALGPVVLAYETCGQLNERADNAVLVLHALTGDSHAAGYYEPGDAKPGWWDLM 89 PLT+ESGR L V +AYE G D +LV HALTGD+HA D +PGWWD + Sbjct: 15 PLTLESGRVLDEVDIAYEAYGDPENARDRTILVCHALTGDAHAGNL----DGQPGWWDGL 70 Query: 90 IGPGKPIDTDRYYVICSNVIGGCMGSTGPSSLDPATGQPYGLTFPVITIGDMVRAQKRLV 149 IGPG+ +DTDR+Y++CSNV+GGC GSTGP+S P G+P+GL FP ITI DMV AQ+ + Sbjct: 71 IGPGRVLDTDRFYIVCSNVLGGCAGSTGPASPGP-DGRPWGLRFPPITIRDMVEAQRLWL 129 Query: 150 EHLGVTKLLSVVGGSMGGMQALEWSVRYPDMVRTAVPLATTTKHSALAIAFNEVARQAIM 209 E LG+T L +V+GGSMGGMQALEW+V YPD V +P+AT+ + SA+AIA+N+V R AIM Sbjct: 130 EKLGITHLYAVIGGSMGGMQALEWAVTYPDRVERCIPIATSARLSAMAIAYNDVMRLAIM 189 Query: 210 ADPNWNGGNYYDGVPPAHGLAVGRMIGHITYLSDEAMRQKFDRRLQDRCENSFVLE-EPD 268 DP WNGG+YY+G PA GLA+ RM+G ITY + +F R + R E ++ E Sbjct: 190 NDPMWNGGDYYNGEKPAAGLALARMVGMITYRGPQLYNARFGRSVVGREEADGPVDFEAR 249 Query: 269 FQVESYLRYQGQKFVDRFDANSFLYITKAADYFNLEASHGCGSAVAAFAKAKCRYLVASF 328 FQVESYLRYQG+K V RFDANS+LY+ KA D ++ G G AA+A+ + +L Sbjct: 250 FQVESYLRYQGEKLVRRFDANSYLYLIKAMDLHDI--GRGRGGVHAAYARTEAEFLCIGI 307 Query: 329 SSDWLYPTYQSRSMVQAMKKNGLDVSFVELEAKWGHDAFLLPNARLSGMIARFLDRA 385 SD LYP + + + + G V + E+ + +GHDAFL+ ++SG + FL+ A Sbjct: 308 DSDILYPAAEQIEIAEGLAATGKRVQYREIRSVYGHDAFLVEFQQMSGALGEFLNPA 364 Lambda K H 0.320 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 463 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 373 Length adjustment: 30 Effective length of query: 367 Effective length of database: 343 Effective search space: 125881 Effective search space used: 125881 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_013074689.1 BTUS_RS03205 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.3644.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-143 464.5 0.0 1.3e-143 464.3 0.0 1.0 1 lcl|NCBI__GCF_000092905.1:WP_013074689.1 BTUS_RS03205 homoserine O-acetyl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000092905.1:WP_013074689.1 BTUS_RS03205 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 464.3 0.0 1.3e-143 1.3e-143 3 350 .. 14 361 .. 12 362 .. 0.97 Alignments for each domain: == domain 1 score: 464.3 bits; conditional E-value: 1.3e-143 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedkGWWdellGpgraldts 71 +ltlesG vl+ev++ay+ yG+ +++rd ++lvcHaltg+ah+ + d +++GWWd l+Gpgr ldt+ lcl|NCBI__GCF_000092905.1:WP_013074689.1 14 GPLTLESGRVLDEVDIAYEAYGDPENARDRTILVCHALTGDAHAGN-LD-GQPGWWDGLIGPGRVLDTD 80 689*****************************************94.44.799**************** PP TIGR01392 72 ryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGGm 140 r+++vc+NvlG+c GstgP+s p+ g+p+g +fP +tirD+v+aq+ l++Lg+++l av+GgS+GGm lcl|NCBI__GCF_000092905.1:WP_013074689.1 81 RFYIVCSNVLGGCAGSTGPASPGPD-GRPWGLRFPPITIRDMVEAQRLWLEKLGITHLYAVIGGSMGGM 148 ************************9.******************************************* PP TIGR01392 141 qalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeeeqPekGLalARmlal 209 qalewa++yp+rv++++++atsar+sa+aia+n+v+r ai++Dp +n+G+y++ e+P++GLalARm+++ lcl|NCBI__GCF_000092905.1:WP_013074689.1 149 QALEWAVTYPDRVERCIPIATSARLSAMAIAYNDVMRLAIMNDPMWNGGDYYNGEKPAAGLALARMVGM 217 ********************************************************************* PP TIGR01392 210 ltYrseesleerfgreakseeslassl..eeefsvesylryqgkkfverFdAnsYllltkaldthdlar 276 +tYr+ + +++rfgr++ +e+ + + e++f+vesylryqg+k+v+rFdAnsYl+l ka+d hd++r lcl|NCBI__GCF_000092905.1:WP_013074689.1 218 ITYRGPQLYNARFGRSVVGREEADGPVdfEARFQVESYLRYQGEKLVRRFDANSYLYLIKAMDLHDIGR 286 ****************9999877765444**************************************** PP TIGR01392 277 grrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekve 343 g r+++++a ++++a++l +gi+sD+l++++eq e+a+ l a++++ y+ei+s +GHDaFl+e+++++ lcl|NCBI__GCF_000092905.1:WP_013074689.1 287 G-RGGVHAAYARTEAEFLCIGIDSDILYPAAEQIEIAEGLAATGKRvqYREIRSVYGHDAFLVEFQQMS 354 *.8**************************************9999889********************* PP TIGR01392 344 elirefl 350 ++ efl lcl|NCBI__GCF_000092905.1:WP_013074689.1 355 GALGEFL 361 9999987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (373 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.81 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory