Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (uncharacterized)
to candidate WP_013075186.1 BTUS_RS05820 anthranilate phosphoribosyltransferase
Query= curated2:Q1IJR5 (347 letters) >NCBI__GCF_000092905.1:WP_013075186.1 Length = 349 Score = 118 bits (296), Expect = 2e-31 Identities = 102/331 (30%), Positives = 162/331 (48%), Gaps = 21/331 (6%) Query: 14 RDLTREQARETMADVLGGKTTDAQIGALLVGLQMKGETVDEIVGFAEAIRAAAT--PLIV 71 RDLTR++AR + TDAQ+GA L+ +MKGET +E+ F E RA A P + Sbjct: 22 RDLTRDEARHMAERMYRRDLTDAQLGAFLLAERMKGETAEEVHAFIETWRAHAPSWPAHL 81 Query: 72 RDSALDVSGTERDALLDTCGTGGDASGTFNISTATALVVAGAGVKVAKHGNRSVTSKCG- 130 ALDV+G G G + TF S A A++ A GVK HG+ + K G Sbjct: 82 LPEALDVAG----------GYDG-RTKTFCASVAAAVLAADLGVKQFLHGSLPLPPKYGL 130 Query: 131 -SADVVEALGVNINLPAERMAECLEKVGIAFLFAPAMHTAMKYVQPARRELKMRTVFNLL 189 +V+ AL V+ + AE A+ +VGI FL + + + ++ R +L +RT + + Sbjct: 131 TVGEVLSALRVSA-VRAESHADRHVRVGIVFLDTESWLSPLAELRSVREQLGLRTFIHSV 189 Query: 190 GPLTNPANASCQVVGVYTGQLVEKLAQALLQLGLKRALVVHGWDGLDEITISGPTKVAEV 249 L NP + ++VG + E+ A G++R +++ G +G ++ + T V V Sbjct: 190 EKLINPGRSEYRIVGAFHRPAFERYAAVCELDGVRRCVLIQGVEGSEDPYPNRATSV-YV 248 Query: 250 RDGKVTSYE-ISPEQFGLQRAPLSALEGGDAQVNAAIIRAILDGERSPKRDVVLLNAAAA 308 DG + E P +GL+ P DA + A ++L GE+S + +AA Sbjct: 249 FDGHRWNIEAFDPRPYGLEADPTCP---PDADLQARYTESVLAGEKSSYARWAVWSAAVR 305 Query: 309 LVAAGQAETMGAAIPVAAYAIDSGQAKGRLR 339 L A G A ++ A+ +G+A+GRL+ Sbjct: 306 LFARGAAVSLDEAVERVRDHWRTGRAEGRLK 336 Lambda K H 0.318 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 349 Length adjustment: 29 Effective length of query: 318 Effective length of database: 320 Effective search space: 101760 Effective search space used: 101760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory