Align 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (characterized)
to candidate WP_013075704.1 BTUS_RS08515 3-phosphoshikimate 1-carboxyvinyltransferase
Query= BRENDA::F5A7Q0 (429 letters) >NCBI__GCF_000092905.1:WP_013075704.1 Length = 433 Score = 444 bits (1142), Expect = e-129 Identities = 226/424 (53%), Positives = 297/424 (70%) Query: 4 RTIQPVNNGLNGNITIPGDKSISHRAVMFGSIAEGKTTIKGFLSGADCLSTISCFKEMGV 63 + I + L G + +PGDKSISHRAVMF S+A+G + ++GFL GADCLST++C + +GV Sbjct: 2 KLIVEMAGALKGQVRVPGDKSISHRAVMFTSLADGVSRVEGFLFGADCLSTVACMRALGV 61 Query: 64 EITQNGDEVTVVGKGLEGLQEPKAVLDVGNSGTTIRLMSGILANTPFFSCVQGDESIAKR 123 + V V G G+ GLQEP VLDVGNSGTTIRL+ G+L+ F SC+ GD SI +R Sbjct: 62 PVDIEDGTVIVHGVGMHGLQEPDDVLDVGNSGTTIRLLLGLLSGQTFHSCLTGDASIRRR 121 Query: 124 PMKRVTNPLKQMGANIDGREEGTFTPLTIRGGDLKAIEYISPVASAQVKSAILLAGLRAE 183 PM RV PL MGA IDGR +G PL++RG DL +I+Y PVASAQVKSAILLAGL A Sbjct: 122 PMGRVAKPLLSMGARIDGRRDGDLAPLSVRGADLHSIKYQMPVASAQVKSAILLAGLFAS 181 Query: 184 GVTAVTEPHISRDHTERMLEAFGVKVTREGKTVKLSGGQKLTATNIQVPGDVSSAAFFLV 243 GVT V EP SRDHTERML+A G +++ ++ +L A ++++PGD+SSAAF LV Sbjct: 182 GVTGVREPSPSRDHTERMLKALGAPISKRSGYTEIGRPARLRAMDMRIPGDLSSAAFLLV 241 Query: 244 AGAIIPNSKLVLQNVGMNPTRTGIIDVLEKMGATFTVDLINEGASEPAANITIETSSLKG 303 A I+P S+L+L++VG+NPTRTGI+DVL MGA F ++ A EP A + + L G Sbjct: 242 ATLIVPGSELILEDVGVNPTRTGILDVLGAMGAQFEIEEGEPQAGEPTARLAARSGPLVG 301 Query: 304 IEIGGDIIPRLIDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIE 363 +GG +IPRLIDEIP++A+AA AEG T I+DA EL+VKET+RI TV EL K G ++ Sbjct: 302 ATVGGSLIPRLIDEIPILAVAAAAAEGTTEIRDARELRVKETDRIRTVAEELRKFGVQVA 361 Query: 364 ATDDGMIIYGKSALKGNTVNSYGDHRIGMMLAIAGCLAEGKTIIEDAEAVGVSYPTFFDE 423 +DG++I G LKG S+GDHRI M +A+AG +AEG+T++E EA VS+P F D Sbjct: 362 ELEDGLMIEGGRVLKGAHCRSHGDHRIAMAMAVAGLVAEGETVVEGWEAADVSFPGFVDL 421 Query: 424 LQKL 427 L++L Sbjct: 422 LREL 425 Lambda K H 0.315 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 585 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 429 Length of database: 433 Length adjustment: 32 Effective length of query: 397 Effective length of database: 401 Effective search space: 159197 Effective search space used: 159197 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (24.3 bits)
Align candidate WP_013075704.1 BTUS_RS08515 (3-phosphoshikimate 1-carboxyvinyltransferase)
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.30406.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-126 408.7 0.0 1.5e-126 408.5 0.0 1.0 1 lcl|NCBI__GCF_000092905.1:WP_013075704.1 BTUS_RS08515 3-phosphoshikimate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000092905.1:WP_013075704.1 BTUS_RS08515 3-phosphoshikimate 1-carboxyvinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 408.5 0.0 1.5e-126 1.5e-126 1 414 [. 13 427 .. 13 428 .. 0.96 Alignments for each domain: == domain 1 score: 408.5 bits; conditional E-value: 1.5e-126 TIGR01356 1 geikipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakveeekeelviegvgg..lk 67 g++++pg+KSishRa+++ +La+g ++v+++L ++D+l+t+ ++r+lG+ v e+++++++gvg+ l+ lcl|NCBI__GCF_000092905.1:WP_013075704.1 13 GQVRVPGDKSISHRAVMFTSLADGVSRVEGFLFGADCLSTVACMRALGVPVDIEDGTVIVHGVGMhgLQ 81 78**************************************************8899*******9999** PP TIGR01356 68 epeaeldlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgaeieskeeegslPlai 136 ep+++ld+gnsGtt+Rll+g+l+ + +++ ltgd s+++RP++r+ ++L ++ga+i+ +++ + +Pl++ lcl|NCBI__GCF_000092905.1:WP_013075704.1 82 EPDDVLDVGNSGTTIRLLLGLLSGQTFHSCLTGDASIRRRPMGRVAKPLLSMGARIDGRRDGDLAPLSV 150 ********************************************************************* PP TIGR01356 137 sgplkggivelsgsaSsQyksalllaaplalqavtleivgeklisrpyieitLkllksfgveveeeder 205 +g i + + aS+Q+ksa+lla+ l a++++ v e+ sr+++e++Lk l++ +++ + lcl|NCBI__GCF_000092905.1:WP_013075704.1 151 RGADLHSIKYQMPVASAQVKSAILLAG---LFASGVTGVREPSPSRDHTERMLKALGAP---ISKRSG- 212 **65559********************...7789**********************998...888877. PP TIGR01356 206 kivvkggqkykqkevevegDaSsAafflaaaaitge.evtvenlgenstqgdkaiiivLeemGadveve 273 + + + + +++++gD+SsAaf+l+a +i ++ e+ +e++g n+t+++ i++vL +mGa+ e+e lcl|NCBI__GCF_000092905.1:WP_013075704.1 213 YTEIGRPARLRAMDMRIPGDLSSAAFLLVATLIVPGsELILEDVGVNPTRTG--ILDVLGAMGAQFEIE 279 67777777777778*********************99***************..888************ PP TIGR01356 274 eqr........dvevegasklkgvkv.didvdsliDelptlavlaafAegetriknieelRvkEsdRia 333 e + + + + l g +v +++liDe+p+lav+aa Aeg+t+i++++elRvkE+dRi+ lcl|NCBI__GCF_000092905.1:WP_013075704.1 280 EGEpqageptaRLAAR-SGPLVGATVgGSLIPRLIDEIPILAVAAAAAEGTTEIRDARELRVKETDRIR 347 ********98777777.67899999999***************************************** PP TIGR01356 334 aiaeeLeklGveveeledgllieGkkkelkgavvdtydDHRiamalavlglaaegeveiedaecvaksf 402 +aeeL+k+Gv+v eledgl+ieG+ + lkga+ ++++DHRiama+av+gl+aege+ +e+ e++++sf lcl|NCBI__GCF_000092905.1:WP_013075704.1 348 TVAEELRKFGVQVAELEDGLMIEGG-RVLKGAHCRSHGDHRIAMAMAVAGLVAEGETVVEGWEAADVSF 415 *************************.7****************************************** PP TIGR01356 403 PeFfevleqlga 414 P F+++l++lga lcl|NCBI__GCF_000092905.1:WP_013075704.1 416 PGFVDLLRELGA 427 *********987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (433 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 8.71 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory