Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate WP_013075711.1 BTUS_RS08550 3-dehydroquinate synthase
Query= BRENDA::Q3M4V2 (363 letters) >NCBI__GCF_000092905.1:WP_013075711.1 Length = 377 Score = 257 bits (656), Expect = 4e-73 Identities = 148/360 (41%), Positives = 223/360 (61%), Gaps = 6/360 (1%) Query: 4 VINVNLPTQSYEIAIAPASLDQIGQSL--AGLKLGKKVLLVSNPTIFKH-FGKVAVDSLE 60 V+ V L + Y I +A +LDQ G+ + GL G L+V++ T+ + + + +L Sbjct: 10 VVWVELGDRRYPIVVADGALDQAGKWMREVGLSPGSAQLIVTDETVDRAGYPRRVAAALT 69 Query: 61 AAGFQVASYCLPAGERYKTLNSIQKLYDIALENRLERSSTMVALGGGVIGDMTGFAAATW 120 A G +V + +PAGE K+L +L++ AL L+R ST+ A+GGG++GD+ GF AAT+ Sbjct: 70 AEGVRVETAVVPAGEPTKSLEWASRLWEAALAAGLDRRSTIWAVGGGMVGDLAGFVAATY 129 Query: 121 LRGINVVQVPTTLLAMVDSAIGGKTGVNHPHGKNLIGAFHQPRFVLIDPQVLKTLPVREF 180 +RGI VQVPTT LA D+A+GGK +N P KN++GAFHQPR VL DP VL +L R+ Sbjct: 130 MRGIAFVQVPTTWLAH-DAAVGGKVAINLPEAKNVVGAFHQPRLVLYDPTVLDSLSTRDV 188 Query: 181 RAGMAEVIKYGVIWDAELFNQLEQSKRLDQLRYIKPELMDAILTRSCQAKADVVGKDEKE 240 +G+AEV+K+ I DAELF++L ++R ++L ++ +L RSC KA VV +DEKE Sbjct: 189 ASGLAEVVKHACIRDAELFHEL--AERGNELLHLAGPDRGRLLARSCAIKARVVEEDEKE 246 Query: 241 GGLRAILNYGHTVGHAVESLTNYRLLKHGEAVGIGMVAAGQIAVNLGLWQQADADRQNAL 300 G RA LN+GHT+GH++E+L +YR +HGEAV +GMV A ++ + +R L Sbjct: 247 SGARAHLNFGHTLGHSLETLGDYRRYRHGEAVAVGMVFAALLSEDWLGAPPETGERIARL 306 Query: 301 IEKAGLPTKLPAGLDIEGIIEALQLDKKVKDGKVRFVLPTQIGVVTVTDEVTSDHIRQVL 360 +E GLP ++P + +I + DKK+ G++ FVL IG + + +R+VL Sbjct: 307 LEGIGLPVRIPEEFTDDDLIHPMYKDKKMIGGRLTFVLLEDIGRARSVTGIPEEAVRRVL 366 Lambda K H 0.319 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 377 Length adjustment: 30 Effective length of query: 333 Effective length of database: 347 Effective search space: 115551 Effective search space used: 115551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_013075711.1 BTUS_RS08550 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.12501.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-112 360.6 0.0 5.5e-112 360.3 0.0 1.0 1 lcl|NCBI__GCF_000092905.1:WP_013075711.1 BTUS_RS08550 3-dehydroquinate sy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000092905.1:WP_013075711.1 BTUS_RS08550 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 360.3 0.0 5.5e-112 5.5e-112 1 341 [. 20 364 .. 20 366 .. 0.96 Alignments for each domain: == domain 1 score: 360.3 bits; conditional E-value: 5.5e-112 TIGR01357 1 ykvkvgegllkklveelae...ka.sklvvitdeevekl.vaekleealkslgvevlvlvvpdgeesKs 64 y+++v +g+l+++ ++++e + s +++tde+v++ + +++++al + gv+v+++vvp+ge +Ks lcl|NCBI__GCF_000092905.1:WP_013075711.1 20 YPIVVADGALDQAGKWMREvglSPgSAQLIVTDETVDRAgYPRRVAAALTAEGVRVETAVVPAGEPTKS 88 6899*************99775226999*******98763799************************** PP TIGR01357 65 letvaklldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtgin 133 le++++l+++ l+++l+r+s++ a+GGG vgDlaGFvAaty+RGi++vqvPTt la+ D++vGGK++in lcl|NCBI__GCF_000092905.1:WP_013075711.1 89 LEWASRLWEAALAAGLDRRSTIWAVGGGMVGDLAGFVAATYMRGIAFVQVPTTWLAH-DAAVGGKVAIN 156 *********************************************************.*********** PP TIGR01357 134 lplgkNliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelea 202 lp+ kN++Gaf+qP++Vl+d++vl +l++r +++G+aEv+Kh++i daelf+el + ++ll+l lcl|NCBI__GCF_000092905.1:WP_013075711.1 157 LPEAKNVVGAFHQPRLVLYDPTVLDSLSTRDVASGLAEVVKHACIRDAELFHELAERGNELLHL-AGPD 224 *********************************************************9999986.5599 PP TIGR01357 203 leelikrsievKaevVeeDekesglRalLNfGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklg 270 +l++rs+ +Ka+vVeeDekesg Ra LNfGHtlgH +E+l +y+ ++HGeaVa+Gmv++a lse lcl|NCBI__GCF_000092905.1:WP_013075711.1 225 RGRLLARSCAIKARVVEEDEKESGARAHLNFGHTLGHSLETLGDYRrYRHGEAVAVGMVFAALLSEDWL 293 9******************************************************************** PP TIGR01357 271 llkaellerlvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaalasevteeel 339 +++e er+++ll+ +glp++++++++ + l++ + kDKK+ g+++++vlle+iG+a + + ++ee++ lcl|NCBI__GCF_000092905.1:WP_013075711.1 294 GAPPETGERIARLLEGIGLPVRIPEEFTDDDLIHPMYKDKKMIGGRLTFVLLEDIGRARSVTGIPEEAV 362 **********************************************************99988888777 PP TIGR01357 340 le 341 + lcl|NCBI__GCF_000092905.1:WP_013075711.1 363 RR 364 65 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (377 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.50 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory