Align Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 (characterized)
to candidate WP_013076129.1 BTUS_RS10910 imidazole glycerol phosphate synthase subunit HisF
Query= SwissProt::Q7SIB9 (252 letters) >NCBI__GCF_000092905.1:WP_013076129.1 Length = 253 Score = 294 bits (753), Expect = 1e-84 Identities = 157/253 (62%), Positives = 194/253 (76%), Gaps = 6/253 (2%) Query: 3 LAKRIVPCLDVHAGRVVKGVNFV-NLRDAGDPVEAARAYDEAGADELVFLDISATHEERA 61 L +RIVPC DV GRVVK V+F+ N RDAGDPVE AR YDE+GADELV LDISA+ E RA Sbjct: 2 LTRRIVPCFDVKNGRVVKNVSFLTNERDAGDPVELARYYDESGADELVLLDISASVEGRA 61 Query: 62 ILLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVRRPELIRELADHF 121 ++DVVAR A VFIPLTVGGG+ S++D R LL +GADKVS+N+ AV+ P+L+ E A + Sbjct: 62 TMVDVVARTAAEVFIPLTVGGGITSVDDIRVLLKAGADKVSINTGAVKHPQLVLEAAKRY 121 Query: 122 GAQAVVLAIDARW---RGDFPEVHVAGGRVPTGLHAVEWAVKGVELGAGEILLTSMDRDG 178 G Q +V+AID ++ +GD+ EV + GGR TGL AVEWA K LGAGEILLTS D+DG Sbjct: 122 GQQCIVVAIDGKYDGQKGDW-EVLINGGRTRTGLSAVEWAKKMENLGAGEILLTSFDQDG 180 Query: 179 TKEGYDLRLTRMVAEAVGVPVIASGGAGRMEHFLEAFQAG-AEAALAASVFHFGEIPIPK 237 K+GYDL TR+++E+V +PVIASGGAG+ EHF E F G A+AALAAS+FHF E I + Sbjct: 181 RKDGYDLTFTRVISESVNIPVIASGGAGKKEHFYEVFTKGKADAALAASIFHFKETTIQE 240 Query: 238 LKRYLAEKGVHVR 250 +KRYL +KGV VR Sbjct: 241 VKRYLRQKGVPVR 253 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 11 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 253 Length adjustment: 24 Effective length of query: 228 Effective length of database: 229 Effective search space: 52212 Effective search space used: 52212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
Align candidate WP_013076129.1 BTUS_RS10910 (imidazole glycerol phosphate synthase subunit HisF)
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00735.hmm # target sequence database: /tmp/gapView.13637.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00735 [M=254] Accession: TIGR00735 Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-118 379.4 1.1 3.9e-118 379.3 1.1 1.0 1 lcl|NCBI__GCF_000092905.1:WP_013076129.1 BTUS_RS10910 imidazole glycerol Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000092905.1:WP_013076129.1 BTUS_RS10910 imidazole glycerol phosphate synthase subunit HisF # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 379.3 1.1 3.9e-118 3.9e-118 1 254 [] 1 253 [] 1 253 [] 0.99 Alignments for each domain: == domain 1 score: 379.3 bits; conditional E-value: 3.9e-118 TIGR00735 1 mlakriipCLdvkdgrvvkGvqfk.nlrdaGdpvelakkydeeGadelvflditassekretmlevver 68 ml++ri+pC+dvk+grvvk v f n rdaGdpvela++yde Gadelv+ldi+as e+r+tm++vv r lcl|NCBI__GCF_000092905.1:WP_013076129.1 1 MLTRRIVPCFDVKNGRVVKNVSFLtNERDAGDPVELARYYDESGADELVLLDISASVEGRATMVDVVAR 69 8**********************62699***************************************** PP TIGR00735 69 vaekvfiPltvgGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakreaen 137 +a +vfiPltvgGGi s++d++ ll+aGadkvsint avk+p+l+ e+a+r+G+q+ivvaid k++ ++ lcl|NCBI__GCF_000092905.1:WP_013076129.1 70 TAAEVFIPLTVGGGITSVDDIRVLLKAGADKVSINTGAVKHPQLVLEAAKRYGQQCIVVAIDGKYDGQK 138 ****************************************************************99875 PP TIGR00735 138 eeakyevtikgGrestdldvvewakeveelGaGeilltsmdkdGtksGydlellkkvkeavkiPviasg 206 + +ev i+gGr++t+l +vewak++e+lGaGeillts+d+dG k+Gydl+ ++ ++e+v+iPviasg lcl|NCBI__GCF_000092905.1:WP_013076129.1 139 --GDWEVLINGGRTRTGLSAVEWAKKMENLGAGEILLTSFDQDGRKDGYDLTFTRVISESVNIPVIASG 205 ..9****************************************************************** PP TIGR00735 207 GaGkaehleeaflkgkadaaLaasvfhkreltieevkeylaergvkvr 254 GaGk+eh++e+f+kgkadaaLaas+fh++e+ti+evk+yl+++gv+vr lcl|NCBI__GCF_000092905.1:WP_013076129.1 206 GAGKKEHFYEVFTKGKADAALAASIFHFKETTIQEVKRYLRQKGVPVR 253 ***********************************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (254 nodes) Target sequences: 1 (253 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 10.13 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory