Align imidazole glycerol-phosphate synthase (subunit 2/2) (EC 4.3.2.10) (characterized)
to candidate WP_013076130.1 BTUS_RS10915 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
Query= BRENDA::A4WHB6 (251 letters) >NCBI__GCF_000092905.1:WP_013076130.1 Length = 281 Score = 114 bits (286), Expect = 2e-30 Identities = 78/244 (31%), Positives = 125/244 (51%), Gaps = 9/244 (3%) Query: 4 RVIPCLDM-DGKAGVVVKGVNFEGVREVGDPVEMAVRYEEEGADEIAILDITATPEGRST 62 ++ P +D+ DG+A + +G + DPV +A R+ +EGA + ++D+ EG Sbjct: 8 QLYPAIDLSDGRAVRLRQGDYGQMTVYGDDPVAVARRWRDEGAGWLHVVDLDGAKEGHPV 67 Query: 63 FVESVRRVAEAVSIPVLVGGGVRGIEDAAALFKAGADKVSVNTAAVKNPRLVSEIAREFG 122 + + R+ EA +PV VGGG+R E ALF G + + TAA++NP + E+ E+G Sbjct: 68 HLPLIGRMVEAAGLPVQVGGGIRDGESLRALFSLGVARCVLGTAALENPVWMKEVLAEYG 127 Query: 123 SQSTVVAIDAKLVGGRYEVFVRGGKEPTGLDAVEWAKKVEELGAGEILLTSIDKDGTRLG 182 + VV +DA+ +V VRG + TG+ AVE ++++E GA L T I +DG G Sbjct: 128 -ERIVVGLDAR----DGKVAVRGWLQNTGVAAVELGRRLKEWGARRALFTDIRRDGAMAG 182 Query: 183 YDVELIRRVAEAVKIPVIASGGA---GALEHFYEAAAAGADAVLAASLFHFRVLTISEVK 239 +AE + VIASGG G ++ Y G +A + L++ E Sbjct: 183 PGGREAAELAEETGLLVIASGGVRHLGDIQRLYALRHRGVAGAVAGRALYTGDLSLKEAT 242 Query: 240 RYLR 243 +LR Sbjct: 243 AWLR 246 Lambda K H 0.318 0.136 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 281 Length adjustment: 25 Effective length of query: 226 Effective length of database: 256 Effective search space: 57856 Effective search space used: 57856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory