Align N-acetylornithine carbamoyltransferase (EC 2.1.3.9) (characterized)
to candidate WP_013076160.1 BTUS_RS11060 ornithine carbamoyltransferase
Query= BRENDA::Q8P8J2 (339 letters) >NCBI__GCF_000092905.1:WP_013076160.1 Length = 318 Score = 144 bits (364), Expect = 2e-39 Identities = 112/334 (33%), Positives = 160/334 (47%), Gaps = 38/334 (11%) Query: 4 KHFLNTQDWSRAELDALLTQAALFKRNKLGSE----LKGKSIALVFFNPSMRTRTSFELG 59 + FL+ D++ EL LL AA+ K + E L GK++ ++F S RTR SFE+G Sbjct: 11 RDFLDLADFTSDELRGLLRLAAVLKEKQKAGERVQPLAGKTLGMIFEKSSTRTRVSFEVG 70 Query: 60 AFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIGVRAFPKFVD 119 QLGGHA+ L + LG E I + ARVL RYVD I +R F Sbjct: 71 MVQLGGHALFLASH------DTQLGR------GEPIPDTARVLSRYVDGIMIRTF----- 113 Query: 120 WSKDREDQVLKSFAKYSPVPVIN-METITHPCQELAHALALQEHFGTPDLRGKKYVLTWT 178 + ++ A+Y+ VPVIN + + HPCQ LA A+ + EH + + +T Sbjct: 114 -----SHESVRELAEYATVPVINGLTDLHHPCQVLADAMTILEH------KSRLEGVTVA 162 Query: 179 YHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDERYMDWAAQNVAESGGSLQVSHD 238 Y N +ANS L A GM++ + P Y D A + A +G + + HD Sbjct: 163 YVGDGNN--MANSWLVGAPLFGMNLRVATPQ-GYECDPGVAARAQELAARAGTEMSLVHD 219 Query: 239 IDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGVFSHCLPLR 298 A AGADV+Y W ++ E E+ +R + + +F HCLP Sbjct: 220 PREAVAGADVIYTDVWASMG--QEAEREERLRAFAGFEVTPALVARAAPDYLFMHCLPAH 277 Query: 299 RNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAA 332 R + V+D P+ + DEAENRLH QKAI+ A Sbjct: 278 RGEEVAPDVIDGPHSVIFDEAENRLHAQKAILVA 311 Lambda K H 0.320 0.134 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 13 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 318 Length adjustment: 28 Effective length of query: 311 Effective length of database: 290 Effective search space: 90190 Effective search space used: 90190 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory