Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_013089788.1 BC1002_RS09275 4-hydroxy-tetrahydrodipicolinate synthase
Query= BRENDA::Q9I4W3 (292 letters) >NCBI__GCF_000092885.1:WP_013089788.1 Length = 305 Score = 347 bits (890), Expect = e-100 Identities = 172/290 (59%), Positives = 218/290 (75%) Query: 2 IAGSMVALVTPFDAQGRLDWDSLAKLVDFHLQEGTNAIVAVGTTGESATLDVEEHIQVIR 61 I GS+ A++TP G LD + KL+D+H++EGTNA+V VGT+GESATL VEEH+ +++ Sbjct: 15 IRGSIPAIITPMLEDGSLDLPAFRKLIDWHIEEGTNALVVVGTSGESATLSVEEHVLMVK 74 Query: 62 RVVDQVKGRIPVIAGTGANSTREAVALTEAAKSGGADACLLVTPYYNKPTQEGMYQHFRH 121 VD GRIPVIAG GANST EA+ LT+ AK GADA L V PYYNKPTQEG+Y+HF Sbjct: 75 TAVDHTAGRIPVIAGAGANSTAEAIELTQHAKDVGADATLQVVPYYNKPTQEGIYRHFAK 134 Query: 122 IAEAVAIPQILYNVPGRTSCDMLPETVERLSKVPNIIGIKEATGDLQRAKEVIERVGKDF 181 IAE+V +P ILYNVPGRT DM ET+ R ++VP I+G+KEATG++ RA +I+ +F Sbjct: 135 IAESVDLPVILYNVPGRTVADMSNETILRCAQVPGIVGVKEATGNIDRAAHLIKSAPANF 194 Query: 182 LVYSGDDATAVELMLLGGKGNISVTANVAPRAMSDLCAAAMRGDAAAARAINDRLMPLHK 241 +YSGDD TA+ LMLLGG GNISVTANVAPRAMS+LC AA+ DA AR I+ +L+ LHK Sbjct: 195 SIYSGDDPTAIALMLLGGHGNISVTANVAPRAMSELCKAALAADAKTAREIHLKLLSLHK 254 Query: 242 ALFIESNPIPVKWALHEMGLIPEGIRLPLTWLSPRCHEPLRQAMRQTGVL 291 LF E+NPIP KWAL ++G + GIRLPLT L + HE +R A+R+ G+L Sbjct: 255 YLFAEANPIPAKWALQQLGRVQGGIRLPLTPLDAQYHEVVRGALREAGLL 304 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 305 Length adjustment: 27 Effective length of query: 265 Effective length of database: 278 Effective search space: 73670 Effective search space used: 73670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_013089788.1 BC1002_RS09275 (4-hydroxy-tetrahydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.31354.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-113 362.0 0.0 9.1e-113 361.8 0.0 1.0 1 lcl|NCBI__GCF_000092885.1:WP_013089788.1 BC1002_RS09275 4-hydroxy-tetrahy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000092885.1:WP_013089788.1 BC1002_RS09275 4-hydroxy-tetrahydrodipicolinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 361.8 0.0 9.1e-113 9.1e-113 1 285 [. 17 300 .. 17 301 .. 0.99 Alignments for each domain: == domain 1 score: 361.8 bits; conditional E-value: 9.1e-113 TIGR00674 1 gvltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvp 69 g+++A+iTP+ edgs+d+ a+ kli+ +ie+g++a+vvvGt GEsatLs+eE++ ++++av+ +++r+p lcl|NCBI__GCF_000092885.1:WP_013089788.1 17 GSIPAIITPMLEDGSLDLPAFRKLIDWHIEEGTNALVVVGTSGESATLSVEEHVLMVKTAVDHTAGRIP 85 589****************************************************************** PP TIGR00674 70 viaGtgsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgv 138 viaG+g+n+t+eaielt++a+++g+d++l+v+PyYnkPtqeG+y+hf +iae+v+lP+ilYnvP+Rt++ lcl|NCBI__GCF_000092885.1:WP_013089788.1 86 VIAGAGANSTAEAIELTQHAKDVGADATLQVVPYYNKPTQEGIYRHFAKIAESVDLPVILYNVPGRTVA 154 ********************************************************************* PP TIGR00674 139 slepetvkrLaeeveivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnva 207 +++ et++r a+ + iv++Kea+g+++r+ ++++ a+++f+++sGdD ++ ++++lG++G iSV++nva lcl|NCBI__GCF_000092885.1:WP_013089788.1 155 DMSNETILRCAQVPGIVGVKEATGNIDRAAHLIKSAPANFSIYSGDDPTAIALMLLGGHGNISVTANVA 223 ********************************************************************* PP TIGR00674 208 pkelkemvkaalegdteeareihqkllklfkalfietNPipvKtalallgliekdelRlPLtelseekk 276 p+ ++e++kaal+ d + areih kll+l+k lf e+NPip K+al+ lg +++ +RlPLt+l+ + + lcl|NCBI__GCF_000092885.1:WP_013089788.1 224 PRAMSELCKAALAADAKTAREIHLKLLSLHKYLFAEANPIPAKWALQQLGRVQG-GIRLPLTPLDAQYH 291 ******************************************************.************** PP TIGR00674 277 eklkevlke 285 e ++ +l+e lcl|NCBI__GCF_000092885.1:WP_013089788.1 292 EVVRGALRE 300 999988875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (305 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.82 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory