Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_013090145.1 BC1002_RS11175 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000092885.1:WP_013090145.1 Length = 359 Score = 325 bits (834), Expect = 9e-94 Identities = 171/358 (47%), Positives = 241/358 (67%), Gaps = 7/358 (1%) Query: 6 QLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHIM 65 +LK LR RID+LD +++ L+++RA A EV VK K A +RPERE V+ + Sbjct: 8 RLKPLRDRIDALDAQLIALLNQRASVALEVGEVK-----KHFNAPVFRPEREMQVIARLQ 62 Query: 66 ELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMA 125 E++ GPL +E ++ ++REIM++ ALE+ ++ AYLGP GT+S+ A ++FG S+ P Sbjct: 63 EMSAGPLADEHISAIWREIMAASRALERSIKAAYLGPVGTYSEQAMHEYFGQSIEGLPCP 122 Query: 126 AIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGET 185 +IDEVFR V AGA ++GVVPVENSTEGAV+ TLD L+ + I GE+ L IHH+LL Sbjct: 123 SIDEVFRSVEAGAADYGVVPVENSTEGAVSRTLDLLLQTQLTIGGELALPIHHNLLTQNG 182 Query: 186 TKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAA 245 +TR+ +HAQ+LAQC++WL + P++ER AVSSNA+AA+ + AAIAGD AA Sbjct: 183 LVG--VTRVCAHAQALAQCQRWLSTNAPHLERQAVSSNAEAARMASEDPTVAAIAGDRAA 240 Query: 246 QLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPFHS 305 YGL I+D P N TRF++IG + P+G D+TS+IVS+ N+PGA+ +LL P Sbjct: 241 IHYGLQVTNALIQDDPHNRTRFVMIGKEPTGPSGYDQTSLIVSVANEPGAMVKLLEPLAR 300 Query: 306 NGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPKA 363 +G+ +TR E+RP+R G W Y F+ID GH DP + L +G +A LK+LGSYP+A Sbjct: 301 HGVSMTRFESRPARVGTWEYYFYIDVEGHRDDPAVAAALAGLGEKAAFLKILGSYPRA 358 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 359 Length adjustment: 29 Effective length of query: 336 Effective length of database: 330 Effective search space: 110880 Effective search space used: 110880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory