Align phosphoserine aminotransferase monomer (EC 2.6.1.1; EC 2.6.1.52) (characterized)
to candidate WP_013091232.1 BC1002_RS17000 aminotransferase class V-fold PLP-dependent enzyme
Query= metacyc::MONOMER-15919 (385 letters) >NCBI__GCF_000092885.1:WP_013091232.1 Length = 355 Score = 143 bits (360), Expect = 9e-39 Identities = 107/343 (31%), Positives = 164/343 (47%), Gaps = 14/343 (4%) Query: 9 LLMIPGPTMVPPEVLNAMALPVIGHRTKDYSNLLEDTIEKLKKVF---ITENDTFLITGS 65 LL+ PGP + V N++ + HR ++ +L E+ +L V+ E L+TGS Sbjct: 2 LLLNPGPVTLTERVRNSLLQTDLCHRESEFFDLQEEARTRLVDVYGLDPNEWQAVLMTGS 61 Query: 66 GTAAMDMAISNIIKRGDKVLNIVTGNFGERFANIVKAYKGEAIRLDVEWGDMAEPEAVK- 124 GTAA++ + ++ K+L + G +GER I Y L +W MA P+ K Sbjct: 62 GTAAVESMTAALVPHNGKLLVVENGVYGERITQIAAQYGIAHEALKHDW--MATPDLAKI 119 Query: 125 -EILDKYDDIKAVTVVHNETSTGARNPIKEIGEVVKDYDALYIVDTVSSLGGDYVNVDKF 183 E LD V V+H+ET+TG N I +G + ++ +VD VSS G + ++ Sbjct: 120 AERLDADQSFTHVAVIHHETTTGRLNDIAALGALCRERGLRLLVDGVSSFGAEAIDFADA 179 Query: 184 HIDICVTGSQKCLAAPPGLAAITVSEKAWEVIKKNDDKVGFYLDLLAYKKYYEEKKQTPY 243 +D + KCL PG + + V A +YLDL + ++++ TP+ Sbjct: 180 SLDALAATANKCLHGVPGASFVLVRRAALARAASRT----YYLDLARLAR-LQDQRNTPF 234 Query: 244 TPSVNLTYALNVAL-DLVLEEGIENRVKRHERLAKATRAGLEAMGIELFAKERARSVTVT 302 TPSV+ YAL AL +L E G R R+ LA+ RAGL A GI SV + Sbjct: 235 TPSVHAYYALVEALRELADEGGWRARHARYAALAEQVRAGLAARGIGSVLPAGESSVVLR 294 Query: 303 SAKYPEGIEDSKFRGILSNKYNIVVAGGQKHLAGKIFRIGHMG 345 + + P GI + L + V+ GQ L+ ++FRI MG Sbjct: 295 AYRLPNGIAYPQLHDALKAR-GFVIYAGQGGLSAELFRISTMG 336 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 355 Length adjustment: 30 Effective length of query: 355 Effective length of database: 325 Effective search space: 115375 Effective search space used: 115375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory