Align asparagine synthase (glutamine-hydrolysing) (EC 6.3.5.4) (characterized)
to candidate WP_013133950.1 ARNIT_RS00680 asparagine synthase (glutamine-hydrolyzing)
Query= BRENDA::B3KYI2 (570 letters) >NCBI__GCF_000092245.1:WP_013133950.1 Length = 593 Score = 149 bits (377), Expect = 2e-40 Identities = 113/374 (30%), Positives = 186/374 (49%), Gaps = 53/374 (14%) Query: 28 LRHRGPDWSGLHCHDDCFLAHQRLAIVD-PTSGDQPLYNEDKTVIVTVNGEIYNHKQLRQ 86 + +RGPD+S + H + H RL+I+D +QP+ +D +++ NGEIYN+K+L Sbjct: 21 MNNRGPDYSKVFAHKNYQFGHTRLSIIDVDDEANQPMIFDD--ILIVFNGEIYNYKELI- 77 Query: 87 KLSSHKFRTGSDCEVIAHLYEEYGEEFVNMLDGMFAFVLLDTRDKSFIAARDAIGITPLY 146 K + T SD EVI LY++YG +F+N L+GMF+FV+ D + + + ARD G P + Sbjct: 78 KSENLLCSTSSDTEVIIRLYQKYGIDFLNKLNGMFSFVIFDLKQEKYFCARDRYGKKPFF 137 Query: 147 LGWGHDGSTWFASEMK---------------ALSDDCERFMSFPPGHIY----------- 180 + D F+S +K ALS + F+S Y Sbjct: 138 Y-YFKDNKFIFSSSIKSIIKILGFTPKLNKVALSQYLQYFVSLNDMTFYNDINKLEASSY 196 Query: 181 ---SSKQGGLRRWYNPHWFSE--DIPSTPYDPILLRETFERAVVKRMMTDVPFGVLLSGG 235 SS + ++++Y + + + D D + E ++V R++ DV G LLSGG Sbjct: 197 MLLSSNELFIKKYYKINTYKKVVDEKQALND---IEELLFKSVESRLVGDVEVGSLLSGG 253 Query: 236 LDSSLVASVVNRYLKESEAARQWGSQLHTFCIGLK---GSPDLKAAKEVADYLGTRHHEL 292 +DSS ++S+ G +++TF +G +L A V+ + + HH L Sbjct: 254 IDSSFISSLYTNIT---------GKRINTFSVGYSDHISYSELDYASLVSKDINSIHHPL 304 Query: 293 YFTVQEGIDALEEVIYHIETYDVTTIRASTPMFLMSRKIKALGVKMVLSGEGSDEIFGGY 352 + + ID +EVI +E + A+ P++ +++ I G+K+VLSGEGSDE+F GY Sbjct: 305 EVSRNDFIDVFDEVIDALEEPHADS--AAFPLYCLTKLINKKGIKVVLSGEGSDELFLGY 362 Query: 353 LYFHKAPNKKEFHE 366 + K +F E Sbjct: 363 DNYSKFLKYYKFKE 376 Score = 34.3 bits (77), Expect = 1e-05 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 9/73 (12%) Query: 382 RANKSTAAWGVEARVPFLDKEFIDVAMSIDPEWKMIRRDLGRIEKWVLRNAFDDEKNPYL 441 + ++ + A +E R PFLD +D S+D + K G K++L+ + Y+ Sbjct: 464 KVDRISMANSIEVRTPFLDFRLVDYLFSVDTKLK-----TGDTNKYLLKKI----ASKYI 514 Query: 442 PKHILYRQKEQFS 454 P+ I+ R K+ F+ Sbjct: 515 PEKIINRTKKGFN 527 Lambda K H 0.320 0.137 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 703 Number of extensions: 31 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 3 Length of query: 570 Length of database: 593 Length adjustment: 36 Effective length of query: 534 Effective length of database: 557 Effective search space: 297438 Effective search space used: 297438 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
Align candidate WP_013133950.1 ARNIT_RS00680 (asparagine synthase (glutamine-hydrolyzing))
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.31152.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-133 432.8 0.5 1.4e-133 432.6 0.5 1.0 1 lcl|NCBI__GCF_000092245.1:WP_013133950.1 ARNIT_RS00680 asparagine synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000092245.1:WP_013133950.1 ARNIT_RS00680 asparagine synthase (glutamine-hydrolyzing) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 432.6 0.5 1.4e-133 1.4e-133 23 517 .] 17 526 .. 2 526 .. 0.88 Alignments for each domain: == domain 1 score: 432.6 bits; conditional E-value: 1.4e-133 TIGR01536 23 mletlahRGPDaegvwkdekeenailghrRLaiidlseg.aQPlsnekevvivfnGEIYNheeLreele 90 l +++ RGPD + v+ + +n +gh RL+iid+ + +QP+ ++ +ivfnGEIYN++eL + + lcl|NCBI__GCF_000092245.1:WP_013133950.1 17 ALSLMNNRGPDYSKVFAH---KNYQFGHTRLSIIDVDDEaNQPMIFDD-ILIVFNGEIYNYKELIKSEN 81 4568899***********...7**************9998*******9.79*************98777 PP TIGR01536 91 ekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekkgelflaRDrlGikPLYyaseqgkllf 159 t sDtEVi+++y+++g +++++L+GmF f+++d k++++f aRDr+G+kP++y+ +++k++f lcl|NCBI__GCF_000092245.1:WP_013133950.1 82 L---LCSTSSDTEVIIRLYQKYGIDFLNKLNGMFSFVIFDLKQEKYFCARDRYGKKPFFYYFKDNKFIF 147 4...599************************************************************** PP TIGR01536 160 aSEiKallalkeikaeldkealaelltlqlvptektlfkevkelepakal...dgeekleeywevekee 225 +S iK+++++ ++++l+k al+++l++ ++ ++ t+++++++le+++++ ++e +++y+++++ + lcl|NCBI__GCF_000092245.1:WP_013133950.1 148 SSSIKSIIKILGFTPKLNKVALSQYLQYFVSLNDMTFYNDINKLEASSYMllsSNELFIKKYYKINTYK 216 *****************************99******************998655566677******** PP TIGR01536 226 vkeseeelveelrelledavkkrlvadvpvgvllSGGlDSslvaaiakkeaksevktFsigfedskdld 294 + +e+++ ++++ell ++v++rlv+dv+vg+llSGG+DSs+++++ + ++++tFs+g+ d+ +++ lcl|NCBI__GCF_000092245.1:WP_013133950.1 217 KVVDEKQALNDIEELLFKSVESRLVGDVEVGSLLSGGIDSSFISSLYTNITGKRINTFSVGYSDHISYS 285 ********************************************************************* PP TIGR01536 295 eskaarkvadelgtehkevliseeevlkeleevilaleeptairasiplyllsklarekgvkVvLsGeG 363 e ++a+ v++++ + h+ +++s++++++ ++evi aleep a++a++ply l+kl+++kg+kVvLsGeG lcl|NCBI__GCF_000092245.1:WP_013133950.1 286 ELDYASLVSKDINSIHHPLEVSRNDFIDVFDEVIDALEEPHADSAAFPLYCLTKLINKKGIKVVLSGEG 354 ********************************************************************* PP TIGR01536 364 aDElfgGYeyfreakaeeale..............lpeaselaekklllqaklakeselke...ll.ka 414 +DElf GY+ + ++ + +++ ++ +++ +++++ l++ +++e+ + + lcl|NCBI__GCF_000092245.1:WP_013133950.1 355 SDELFLGYDNYSKFLKYYKFKeslsadqdgflkdiISALQNNTKESEYLRRVVTDENIYNSfgeIYtTI 423 *************99999999776666666655543333333333333333333333222200022022 PP TIGR01536 415 kleeelkekeelkkelkeeseleellrldlelllsdllrak.DrvsmahslEvRvPflDkelvelalsi 482 + ++ k+ + k+e +++ ++ + + dl+ +l + l+ k Dr+sma+s+EvR PflD +lv++ +s+ lcl|NCBI__GCF_000092245.1:WP_013133950.1 424 QKKRLFKRLPTFKQEKAKKDPVDWMSYIDLKIWLGQSLLSKvDRISMANSIEVRTPFLDFRLVDYLFSV 492 22333333333444444448999********************************************** PP TIGR01536 483 ppelklrdgkeKvlLreaaeellPeeileRkKeaf 517 +++lk+ d ++K+lL+++a +++Pe+i +R K++f lcl|NCBI__GCF_000092245.1:WP_013133950.1 493 DTKLKTGD-TNKYLLKKIASKYIPEKIINRTKKGF 526 **999875.68*********************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (593 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 12.57 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory