Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117) (characterized)
to candidate WP_013135200.1 ARNIT_RS06975 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
Query= BRENDA::Q8NRE3 (297 letters) >NCBI__GCF_000092245.1:WP_013135200.1 Length = 395 Score = 174 bits (442), Expect = 2e-48 Identities = 105/257 (40%), Positives = 144/257 (56%), Gaps = 19/257 (7%) Query: 58 DAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLS 117 D P +L+L+ LS + ++NL+G FG+L N WT P ++ L Sbjct: 139 DTNPVSVESVYLKLYALSLGKAKLRSLNLNGAFGVLENCAWTGSQPIELEWLRANEISLK 198 Query: 118 RRGQVT-VYSVDKFPRMVDYVVPSG-VRIGDADRVRLGAYLADGTTVMH-EGFVNFNAGT 174 Q + VDKFPR + +V+P+ RI + +VR GA LA GTTVM ++NFNAGT Sbjct: 199 ITNQYPEITMVDKFPRFLSHVIPANNTRILETSKVRFGAQLAAGTTVMPGAAYINFNAGT 258 Query: 175 LGASMVEGRISAGVTVDDGTDVGGGASIMGTLSGGGQHVISLGKRCLLGANSGCGIPLGD 234 GA MVEGRIS+ V G+DVGGGASI+G LSG +S+G+ LLGANS G +GD Sbjct: 259 EGAVMVEGRISSSAVVGAGSDVGGGASILGVLSGTDGIPVSIGENTLLGANSCTGTAIGD 318 Query: 235 DCIIEAGLYITAGTKVLFDGS----------------LHKASTLAGSNGLIFRRDSVSGQ 278 CI++AG+ I GTK+ + K S G NG+ FR +S +GQ Sbjct: 319 GCILDAGVTILPGTKIALSEKAVAQLKEINPDKEITPMMKGSDFIGVNGVHFRVNSQTGQ 378 Query: 279 VVAVPNTKVVELNTALH 295 VA+ +T+ V+LN+ LH Sbjct: 379 TVAMRSTREVKLNSDLH 395 Lambda K H 0.319 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 395 Length adjustment: 29 Effective length of query: 268 Effective length of database: 366 Effective search space: 98088 Effective search space used: 98088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory