Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95 (uncharacterized)
to candidate WP_013257549.1 DEBA_RS03615 hydroxyacid dehydrogenase
Query= curated2:O29445 (527 letters) >NCBI__GCF_000143965.1:WP_013257549.1 Length = 316 Score = 291 bits (746), Expect = 2e-83 Identities = 146/315 (46%), Positives = 211/315 (66%) Query: 1 MKVLVAEPISEEAIDYMRKNGLEVEVKTGMSREELIREVPKYEAIVVRSQTKVDAEVIQA 60 MK+LV++P+ E+ ++ + G EVEVKTG+ E L + + +V+RS TKV AE++ A Sbjct: 1 MKILVSDPLHEKGVEIFKNEGFEVEVKTGLDPEALKAAMAGVDGLVIRSATKVTAELLAA 60 Query: 61 AKNLKIIGRAGVGVDNIDINAATQRGIVVVNAPGGNTISTAEHAIALMLAAARKIPQADR 120 A +LK++GRAG G+DN+DI A T +G++V+N PG N+ + AE A+ + A +R I + + Sbjct: 61 ADSLKVVGRAGTGLDNVDIPACTAKGVIVMNTPGQNSNAAAELAMGHIFAVSRHIGRGNA 120 Query: 121 SVKEGKWERKKFMGIELRGKTAGVIGLGRVGFEVAKRCKALEMNVLAYDPFVSKERAEQI 180 VK+GKWE+K+ G EL+GKT G+IGLG +G +A+ +M+VL +DPF+ E + Sbjct: 121 GVKQGKWEKKQLRGRELKGKTLGIIGLGNIGRILAELATGCKMSVLGFDPFMDAEAIKAR 180 Query: 181 GVKLVDFDTLLASSDVITVHVPRTKETIGLIGKGQFEKMKDGVIVVNAARGGIVDEAALY 240 G + V FD LLA SD +++HVP+TK+T GL F KMKDG I++N ARGGIV E L Sbjct: 181 GAEPVSFDDLLARSDYVSIHVPKTKQTAGLFNAATFAKMKDGAILINCARGGIVVEEDLC 240 Query: 241 EAIKAGKVAAAALDVYEKEPPSPDNPLLKLDNVVTTPHIAASTREAQLNVGMIIAEDIVN 300 A++ GK+A AALDV+E EP ++ LL D+VV TPH+ A+T EAQ NV + +A + Sbjct: 241 AALEQGKLAGAALDVFEVEPLPANSRLLYADDVVCTPHLGANTYEAQENVAVAVANQMSR 300 Query: 301 MAKGLPVRNAVNLPS 315 KG P AVN P+ Sbjct: 301 FLKGGPAEFAVNAPA 315 Lambda K H 0.317 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 527 Length of database: 316 Length adjustment: 31 Effective length of query: 496 Effective length of database: 285 Effective search space: 141360 Effective search space used: 141360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory