Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate WP_013257691.1 DEBA_RS04350 inositol monophosphatase family protein
Query= curated2:P56160 (259 letters) >NCBI__GCF_000143965.1:WP_013257691.1 Length = 266 Score = 95.5 bits (236), Expect = 1e-24 Identities = 64/197 (32%), Positives = 98/197 (49%), Gaps = 9/197 (4%) Query: 39 VTEADRNAEELIRQGISAKFPDDGLFGEEFDEHPSGNGRR----WIIDPIDGTRSFIHGV 94 VT+AD ++ + I + PD + EE P+ R W++DP+DGT +FIHG Sbjct: 39 VTDADLASQRAVLAVIEERHPDHAILAEEERGDPATAARTPGVLWVVDPLDGTTNFIHGF 98 Query: 95 PLYGVMIALEVEGAMQLGVINFPALGELYQAERGSGAFMNGSPVQVSAIAENSASTVV-- 152 P+ V +A G G I GE ++A RG GAF++ P++V+ I + S ++ Sbjct: 99 PMAAVSVAAVAGGRPLAGAIIDVVHGEEFKAARGLGAFVDDRPMRVADIEDRSQCLLLTG 158 Query: 153 --FTEKEYLLDPPSNHPVDQLRIDAGLVRGWGDCYGHMLVASGRAEVAVDKIMSPWDCAA 210 F ++ LDP + +G+ R VA+GRA+ + + PWD AA Sbjct: 159 FPFRDRG-RLDPYLELFKELFGQSSGVRRAGSAALDLAYVAAGRAQGFWEMGLKPWDVAA 217 Query: 211 VIPIVEEAGGCCFDYRG 227 I +VEEAGG D+ G Sbjct: 218 GIVLVEEAGGVVSDFAG 234 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 266 Length adjustment: 25 Effective length of query: 234 Effective length of database: 241 Effective search space: 56394 Effective search space used: 56394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory