Align alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_013258202.1 DEBA_RS06895 alanine transaminase
Query= BRENDA::D2Z0I0 (402 letters) >NCBI__GCF_000143965.1:WP_013258202.1 Length = 389 Score = 472 bits (1215), Expect = e-138 Identities = 229/389 (58%), Positives = 287/389 (73%), Gaps = 5/389 (1%) Query: 7 FPKVKKLPKYVFAMVNELKYQLRREGEDIVDLGMGNPDIPPSQHIIDKLCEVANRPNVHG 66 F ++K+LP YVFA+V ELK RR GEDI+DLGMGNPD+P HI++KL E A + H Sbjct: 4 FRRMKRLPPYVFAVVTELKMAARRRGEDIIDLGMGNPDLPTPDHIVEKLVEAARKGANHR 63 Query: 67 YSASKGIPRLRKAICDFYKRRYGVELDPERNAIMTIGAKEGYSHLMLAMLEPGDTVIVPN 126 YSASKGI +LR AI +YKRRY V++DPE A+ TIG KEG SHL+LA + PGD V+ P+ Sbjct: 64 YSASKGITKLRHAIAAWYKRRYDVDIDPETEAVATIGVKEGLSHLVLATISPGDVVLAPS 123 Query: 127 PTYPIHYYAPIICGGDAISVPILPEEDFPEVFLRRLYDLIKTSFRKPKAVVLSFPHNPTT 186 PTYPIH Y+ +I GGD +VPILP+ DF E L ++ ++ +PK ++ SFPHNPTT Sbjct: 124 PTYPIHPYSVVIAGGDLRNVPILPDRDFFE----DLQTALRQTWPQPKMLITSFPHNPTT 179 Query: 187 LCVDLEFFQEVVKLAKQEGIWIVHDFAYADLGFDGYTPPSILQVEGALDVAVELYSMSKG 246 +CVDL F ++V+ K+ IW+VHDFAYADL FDGY PS+LQV GA D+AVE +S SK Sbjct: 180 VCVDLAFMTKLVEFCKENQIWLVHDFAYADLTFDGYEAPSVLQVPGAKDIAVEFFSASKS 239 Query: 247 FSMAGWRVAFVVGNEMLIKNLAHLKSYLDYGVFTPIQVASIIALESPYEVVEKNREIYRR 306 +SMAGWR+ F VGN ++ L +KSYLDYGVF PIQ+A IIAL E V++ E+YR Sbjct: 240 YSMAGWRLGFCVGNREMVNALTRIKSYLDYGVFQPIQIAGIIALNEDQECVKQIVEVYRS 299 Query: 307 RRDVLVEGLNRVGWEVKKPKGSMFVWAKVPEEV-GMNSLDFSLFLLREAKVAVSPGIGFG 365 RRDVL+ GL R+GW V PKG+MFVWAK+PE S++F L+ EAKVAVSPGIGFG Sbjct: 300 RRDVLINGLERIGWHVPSPKGTMFVWAKIPEPYRAAGSVEFCKKLVEEAKVAVSPGIGFG 359 Query: 366 EYGEGYVRFALVENEHRIRQAVRGIKKAL 394 EYG+ YVRFALVENE RI QA+RG++K L Sbjct: 360 EYGDEYVRFALVENEQRINQAIRGLRKFL 388 Lambda K H 0.322 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 389 Length adjustment: 31 Effective length of query: 371 Effective length of database: 358 Effective search space: 132818 Effective search space used: 132818 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory