Align UPF0210 protein MMP1427 (characterized, see rationale)
to candidate WP_013258744.1 DEBA_RS09675 PFL family protein
Query= uniprot:Q6LXC5 (458 letters) >NCBI__GCF_000143965.1:WP_013258744.1 Length = 452 Score = 489 bits (1258), Expect = e-142 Identities = 244/454 (53%), Positives = 326/454 (71%), Gaps = 7/454 (1%) Query: 5 EEIIETIKMIEYQNLDIRTTTLGINLKDCADKDLDLLKENIYDKITSLGGNLVETANKVS 64 +E +ET MI + N DIR TLG+NLKD D+D++ + + ++ +G LV+ A+++S Sbjct: 6 QEALETAGMILFDNFDIRAVTLGVNLKDLIDRDIERMSAAVAGRLADMGRRLVDEASRIS 65 Query: 65 QKYGIPIVNKRISVTPIGLIMGSTVKGLSDEEAVDACVEVGITLDKIAKEVGVDFIGGYS 124 +G+PIVNKR+S+TP ++ + +A V + +D+ A GVDF+GG+ Sbjct: 66 DSFGVPIVNKRLSITPAAWLLEACPHD-------EAPVVLAQAIDRGACRAGVDFVGGFG 118 Query: 125 ALVQKRATYEEKMLIRSIPKLMTKTDKVCASVNVATTKAGINMYAVKKMGEIVKETSEIT 184 ALV+K AT ++ L+ ++P+ + T ++C +N+A+T AG+NM A+ ++G I+K + Sbjct: 119 ALVEKGATKADRRLMEALPQALGSTQRLCGFLNLASTSAGMNMDAIARLGHILKAMAAAA 178 Query: 185 KDAIGCAKIVVFCNAPEDNPFMAGAFHGPGEGDAVINAGVSGPGVVRAVVEQLKGKDIGT 244 + CAK V F NAP DNPFMAGAFHG EGD +N G+SGPGVVRAVVE+ D+ Sbjct: 179 PLGLACAKFVAFANAPSDNPFMAGAFHGAQEGDTALNVGISGPGVVRAVVEKHPDCDLTM 238 Query: 245 VSDEIKKTAFKITRMGELVGKEVANELGVNFGIVDLSLAPTPAIGDSIANILEAVGLERC 304 +S+ I++T FKITR GELVG+E+A LGVNFG+VD+SLAPT A+GDS+ ILE++GLE+ Sbjct: 239 LSEVIRRTVFKITRAGELVGRELAKRLGVNFGVVDISLAPTTAVGDSVGQILESMGLEKV 298 Query: 305 GTHGTTAALAMLNDAVKKGGAMASSNVGGLSGAFIPVSEDAGMIEAVEVGALRLEKLEAM 364 G GTTAALA+L DAVK+GGAMAS NVGGLSG FIPVSED MI+AVE GAL LEKLEAM Sbjct: 299 GAPGTTAALALLIDAVKRGGAMASGNVGGLSGTFIPVSEDLAMIDAVECGALGLEKLEAM 358 Query: 365 TCVCSVGLDMIAVPGKTPASTLSAIMADEMAIGMINKKTTAVRIIPVPGKDVGDYVEYGG 424 T VCSVGLDM AVPG +TLSAI+ADE++IG+ N KTT VR+IP PG GD V++GG Sbjct: 359 TAVCSVGLDMFAVPGDVEPATLSAIIADELSIGVANNKTTGVRMIPAPGTKPGDSVDFGG 418 Query: 425 LLGTAPIMPVSEFSSEELIERGGRIPAPIQSLTN 458 LLG AP+M V+ FS + I RGGR+PAPI +L N Sbjct: 419 LLGRAPVMAVNRFSGAKFIGRGGRMPAPITALRN 452 Lambda K H 0.315 0.135 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 656 Number of extensions: 28 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 458 Length of database: 452 Length adjustment: 33 Effective length of query: 425 Effective length of database: 419 Effective search space: 178075 Effective search space used: 178075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory