Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate WP_013259447.1 DEBA_RS13215 aspartate carbamoyltransferase catalytic subunit
Query= curated2:Q9YAE7 (314 letters) >NCBI__GCF_000143965.1:WP_013259447.1 Length = 308 Score = 143 bits (361), Expect = 5e-39 Identities = 107/312 (34%), Positives = 157/312 (50%), Gaps = 21/312 (6%) Query: 9 RHLLWLADYTGEEIRHMVELTLEMKRRYYAGERVIPVLRGRSVGLLFEKPSTRTRISLEV 68 +HLL L + EEI +++ +K + +P LRGR+V L F +PSTRT+ S ++ Sbjct: 6 KHLLGLEGLSAEEIGVVLDTAESLKEINARPIKKVPTLRGRTVVLFFYEPSTRTKTSFDL 65 Query: 69 AVAQLGGHTVYMTPSETQLGRGETVADTARVLSRYL-DAIVARVRSHKTLEEMARHASIP 127 A +L V + P + L +GET+ DTA+ L D IV R S +ARH ++ Sbjct: 66 ACKRLSADAVALAPKTSSLTKGETLIDTAQTLQAMSPDLIVMRHSSSGAPHLLARHVNVS 125 Query: 128 VIN-GLSDLTHPLQAIADMATILEKKGRLEGVKLAFVGD-GADNVLHSLLLAGSKLGLHI 185 +IN G HP QA+ DM TI EKKGR++G+++A +GD V S ++ +G + Sbjct: 126 IINAGDGAHEHPTQALLDMLTIREKKGRVQGLEVAIIGDITHSRVARSNIIGLRTMGARV 185 Query: 186 TVATPPQIRPDERILSIALKAAEESGGSVEIVSDPYEAVRGADVVYTDVWVSMGQESMAE 245 V PP + P A G V D EAV GADVV + + + QE + + Sbjct: 186 RVYGPPTLLPPH---------AATLGARVARSMD--EAVEGADVV---MMLRVQQERLHD 231 Query: 246 EKVQLLKPYQVNAKLMEATGGRA----IFMHCLPAKRGQEVTDEVIDGPWSAVWDQAENR 301 L+ Y L E+ RA I MH P RG E+ +V DGP+S + DQ N Sbjct: 232 VLFPSLREYSRLYGLGESHLRRAAEGVIVMHPGPINRGVEIAPQVADGPYSVILDQVANG 291 Query: 302 LHAHKAVLSLLV 313 + A+L L++ Sbjct: 292 VAVRMALLYLMI 303 Lambda K H 0.319 0.134 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 308 Length adjustment: 27 Effective length of query: 287 Effective length of database: 281 Effective search space: 80647 Effective search space used: 80647 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory