GapMind for Amino acid biosynthesis

 

Alignments for a candidate for leuD in Rhodomicrobium vannielii ATCC 17100

Align 3-isopropylmalate dehydratase (EC 4.2.1.33) (characterized)
to candidate WP_013418829.1 RVAN_RS05815 aconitate hydratase AcnA

Query= BRENDA::Q58673
         (168 letters)



>NCBI__GCF_000166055.1:WP_013418829.1
          Length = 916

 Score = 47.0 bits (110), Expect = 9e-10
 Identities = 37/126 (29%), Positives = 58/126 (46%), Gaps = 16/126 (12%)

Query: 56  IIVGGKNFGCGSSREHAPLGLKGAGISCVIAESFARIFYRNAINVG-LPLIECKGISEKV 114
           ++  G+ +G GSSR+ A  G +  G+  VIA+SF RI   N + +G LPL+   G+S + 
Sbjct: 789 VVFAGREYGTGSSRDWAAKGTRLLGVRAVIAQSFERIHRSNLVGMGVLPLVFEDGMSWQA 848

Query: 115 N--EGDELEVNLETGEI---KNLTTGEVLKGQKLPEFMM----------EILEAGGLMPY 159
               G E       GE+   K +T         L    +              AGG++PY
Sbjct: 849 LGLTGSETVTIRGLGELAPQKRMTAEIAFADGALKNVPLLCRIDTVDELAYFRAGGILPY 908

Query: 160 LKKKMA 165
           + +K+A
Sbjct: 909 VLRKLA 914


Lambda     K      H
   0.317    0.139    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 362
Number of extensions: 18
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 168
Length of database: 916
Length adjustment: 30
Effective length of query: 138
Effective length of database: 886
Effective search space:   122268
Effective search space used:   122268
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory