Align Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate WP_013420658.1 RVAN_RS15510 ornithine--oxo-acid transaminase
Query= curated2:Q5JFW3 (362 letters) >NCBI__GCF_000166055.1:WP_013420658.1 Length = 411 Score = 246 bits (627), Expect = 1e-69 Identities = 152/373 (40%), Positives = 201/373 (53%), Gaps = 24/373 (6%) Query: 10 LVRGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEKIVVAGPMFEHDERE 69 L RGEGV+VWD +G RYLD ++G GH HP+ M Q K+ + F +D+ Sbjct: 38 LSRGEGVWVWDVEGNRYLDCLSGYSAVNQGHCHPKIREAMVEQAGKLTLTSRAFRNDQLA 97 Query: 70 EMLEELSHWVDYEYVYMGNSGTEAVEAAIKFAR--------LATGRSEIVAMTNAFHGRT 121 EEL V N+G EAVE AIK R + ++EI+ FHGRT Sbjct: 98 PFFEELCKLTRSHRVLPMNTGAEAVETAIKIVRKWGYTVKGVPQDKAEIIVFDKNFHGRT 157 Query: 122 LGSLSATWKKKYREGFGPLVPGFKHIPFNNVEAAKEAITKETAAVIFEPIQGEGGIVPAD 181 +S + + REGFGP PGFK IPF +++A ++A+T T AV+ EPIQGE G++ Sbjct: 158 TTVVSFSTDETAREGFGPFTPGFKIIPFGDIKALEDAVTPNTVAVLMEPIQGEAGVIIPP 217 Query: 182 EEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYGVRPDIVTMGKGIGNGF-PVS 239 +VK R+L + I DE+Q+GL RTGK LA EH GV D+ +GKG+ GF PVS Sbjct: 218 PGYVKAARELCTREKIVFILDEIQTGLGRTGKLLAEEHEGVESDMTLLGKGLSGGFYPVS 277 Query: 240 LTLTDLEI----PRGKHGSTFGGNPLACRAVATTLRILRRDRLVEKAGEKFMEFS----- 290 L+ I G+HGSTFGGNPLAC LR++ + +VE + FS Sbjct: 278 AVLSTSRIMGVLKPGEHGSTFGGNPLACAVARAALRVVTEEGMVENSAAMGAYFSEGLRA 337 Query: 291 -GERVVK-TRGRGLMIGIVLRRPAG---NYVKALQERGILVNTAGNRVIRLLPPLIIEGD 345 VVK RGRGLM+ I L AG Y AL+ RGIL IR+ PPLII+ Sbjct: 338 INSHVVKEIRGRGLMMAIELHPDAGGARRYCAALKHRGILCKDTKEHTIRVSPPLIIKRA 397 Query: 346 TLEEARKEIEGVL 358 +++A + VL Sbjct: 398 EVDQALVKFAAVL 410 Lambda K H 0.320 0.140 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 411 Length adjustment: 30 Effective length of query: 332 Effective length of database: 381 Effective search space: 126492 Effective search space used: 126492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory