Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_013450220.1 CALNI_RS00440 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000183405.1:WP_013450220.1 Length = 356 Score = 311 bits (797), Expect = 2e-89 Identities = 160/360 (44%), Positives = 228/360 (63%), Gaps = 6/360 (1%) Query: 5 DQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHI 64 D+L LR +ID +D ILDL++ RAR E+ +K K++ A Y P RE + + + Sbjct: 2 DRLNELRQQIDEIDNTILDLLNRRARLVIEIGHIK-----KSQNAPLYVPSREKAIYERL 56 Query: 65 MELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPM 124 LN GP N+ + +FREI+S+ L+LE+ +VAYLGP+GTF+ AA+KHFG SV P Sbjct: 57 KALNPGPFPNDALRNVFREIISASLSLEEVQKVAYLGPQGTFTHLAAIKHFGLSVKPIPC 116 Query: 125 AAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGE 184 +I EVF +V ++GVVP+ENS EG VNHTLD F + ++ ICGE+ L + HHL+ + Sbjct: 117 RSIPEVFEDVEKKRCDYGVVPIENSLEGVVNHTLDMFSQSNLKICGEIFLEVSHHLM-NK 175 Query: 185 TTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMA 244 T K + + R+YSH ++AQCRKW+ + PNV V V S A AA+ ++ AAI+ +MA Sbjct: 176 TGKIEDVKRVYSHPHAIAQCRKWITENIPNVPIVEVESTAKAAEIASTDETIAAISSEMA 235 Query: 245 AQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPFH 304 Y L + + IED N TRFL+IG+ E PTG+DKTSI+ S+ ++ G+L L F Sbjct: 236 ELQYNLKIIYKNIEDMSNNFTRFLVIGNFEPEPTGNDKTSILFSVTHRSGSLFHALKAFA 295 Query: 305 SNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPKAV 364 I++T+IE+RPS+ W Y+F++D GH + IK LEK +K+LGSYPK V Sbjct: 296 EEEINMTKIESRPSKLKAWEYIFYVDIDGHSKTEKIKKALEKFSENVSFMKILGSYPKGV 355 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 356 Length adjustment: 29 Effective length of query: 336 Effective length of database: 327 Effective search space: 109872 Effective search space used: 109872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_013450220.1 CALNI_RS00440 (prephenate dehydratase)
to HMM PF01817 (CM_2)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF01817.25.hmm # target sequence database: /tmp/gapView.26861.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-28 83.5 0.1 1.4e-27 82.3 0.1 1.6 1 lcl|NCBI__GCF_000183405.1:WP_013450220.1 CALNI_RS00440 prephenate dehydra Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000183405.1:WP_013450220.1 CALNI_RS00440 prephenate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 82.3 0.1 1.4e-27 1.4e-27 1 79 [] 8 85 .. 8 85 .. 0.97 Alignments for each domain: == domain 1 score: 82.3 bits; conditional E-value: 1.4e-27 CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlre...gaeelgldpeavekifr 68 R++IdeiD+ +l+Ll++R++l+ ei+++Kk+++ p + p+Re+++ erl++ g+ ++++a++++fr lcl|NCBI__GCF_000183405.1:WP_013450220.1 8 RQQIDEIDNTILDLLNRRARLVIEIGHIKKSQNAPLYVPSREKAIYERLKAlnpGP----FPNDALRNVFR 74 9**************************************************97777....*********** PP CM_2 69 eiisesralQk 79 eiis+s++l++ lcl|NCBI__GCF_000183405.1:WP_013450220.1 75 EIISASLSLEE 85 *******9985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (79 nodes) Target sequences: 1 (356 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.49 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory