Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate WP_013450396.1 CALNI_RS01310 imidazole glycerol phosphate synthase subunit HisF
Query= curated2:Q7NMQ9 (255 letters) >NCBI__GCF_000183405.1:WP_013450396.1 Length = 253 Score = 130 bits (326), Expect = 3e-35 Identities = 77/211 (36%), Positives = 119/211 (56%), Gaps = 10/211 (4%) Query: 3 IIPAIDILDGRCVRLYQGNYQLAETYGEDPVAVACNWAKLGAPRLHVVDLDGARQGMPVH 62 IIP +D+ DGR V+ G L DPV VA + + GA L +D+ + + + Sbjct: 6 IIPCLDVKDGRVVK---GTQFLNLIDAGDPVQVAEEYDRQGADELTFLDITASHENRGII 62 Query: 63 LDALEAIVTQVPCPVQFGGGLRSIEAVSAVLDRGVDRVILGTAAVENPALIRECCERFGG 122 LD + +V P+ GGG+R+IE + +L+ G D+V + TAAV+NP +++ RFG Sbjct: 63 LDVVAKTAEKVFMPLTVGGGIRTIEDIRKLLNSGADKVSINTAAVKNPDFVKDAALRFGS 122 Query: 123 R-IAVGLDAR------GGQVAVRGWRETSEVEVTELAGEMEKLGVSAIVYTDILKDGTLT 175 + I V +DA+ G +V G R + ++V E A +ME G I+ T + KDGT Sbjct: 123 QCIVVAIDAKRKTNGSGWEVYTHGGRNPTGIDVLEWAVKMESFGAGEILLTSMDKDGTKD 182 Query: 176 GPNLVELQRLTDAVKVPIIASGGVGTLADVL 206 G +L ++DA+++P+IASGGVGT D+L Sbjct: 183 GYDLELTAAVSDAIRIPVIASGGVGTKEDIL 213 Lambda K H 0.321 0.141 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 253 Length adjustment: 24 Effective length of query: 231 Effective length of database: 229 Effective search space: 52899 Effective search space used: 52899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory