Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_013450927.1 CALNI_RS04020 hypothetical protein
Query= BRENDA::Q939C9 (436 letters) >NCBI__GCF_000183405.1:WP_013450927.1 Length = 435 Score = 443 bits (1140), Expect = e-129 Identities = 224/437 (51%), Positives = 305/437 (69%), Gaps = 9/437 (2%) Query: 1 MNDAAKELNRTLSEENPHVLHMLSDLGRELFYPKGVLTQSAEAKAKAGKYNATIGIATSQ 60 MN AKELN ++ ENP VL MLS+LG+ L++PKG+LTQSAEAK KA KYNATIGIAT + Sbjct: 1 MNPLAKELNDIIASENPVVLDMLSELGKNLYFPKGILTQSAEAKEKAYKYNATIGIATEK 60 Query: 61 GESMHFSHIQETLSAYNPDDIYDYAPPQGKEPLRQEWLKKMRLENPSLAGKDISTPIVTN 120 M+ I E L + P D++ YAP G+ LR++W +K ENPS+ GK TPIVTN Sbjct: 61 DGPMYLDCIYEPLKTFKPADLFPYAPATGRADLRKKWREKQIEENPSMKGKFFGTPIVTN 120 Query: 121 ALTHGLSIAADLFVNEGDTLLLPDKYWGNYNFIFGVRRKASIETYPLFQQDGRFNAAGL- 179 ALTHGLSI AD+FV++GD +LLPD +WGNY F R + T+ F G F+ + Sbjct: 121 ALTHGLSIIADMFVDKGDYVLLPDMFWGNYRLTFNTRCGGEVVTFNTFTPQGGFDVDAML 180 Query: 180 --SELLKKQEEKAIVVLNFPNNPTGYTPGEEEASEIVSVILEAAEAGKEIVVLVDDAYYN 237 ++ L +++ K +++LNFPNNP+GY P +E ++ ++ AE+G +++V+ DDAY+ Sbjct: 181 AKAKELGEKKGKVLLILNFPNNPSGYMPTVDEGQKMAEGLVALAESGIKLIVVTDDAYFG 240 Query: 238 LFYDETAIQESIFSKLAQVHDRVLCVKIDGATKENYAWGFRVGFITY---STKSEKAL-R 293 LF+++T + ES+F K+ +L +K+DGATKE Y WGFRVGFIT+ TK + + Sbjct: 241 LFFEDT-MTESLFGKVINRSKNLLAIKLDGATKEEYVWGFRVGFITFGGTDTKDQPGIFT 299 Query: 294 VLEEKTKGIIRGTISSAPHPSQTFMLRAMQSPEYEKEKSLKYNIMKKRADKVKAVLAENK 353 LE+K GIIRGTIS+ PHPSQTF+L + P+++K+K KY IMK+RA++VK VL K Sbjct: 300 ALEKKVAGIIRGTISNCPHPSQTFVLYGLNHPDFKKQKEEKYQIMKQRANRVKDVLNSGK 359 Query: 354 HYEDVWTPYPFNSGYFMCVRLKDINAGELRVSLLEKRGIGTISINETDLRIAFSCVEEEH 413 Y+D + YPFNSGYFMC++LK+++A LRV LL G+GTIS+N+TDLRIAFSC+E E Sbjct: 360 -YDDEFVYYPFNSGYFMCLKLKNVDAEALRVHLLNNYGVGTISVNKTDLRIAFSCMEVED 418 Query: 414 IADLFEEIYQEAKQLQK 430 I DLF IYQ K L+K Sbjct: 419 IEDLFNIIYQGCKDLRK 435 Lambda K H 0.315 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 586 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 435 Length adjustment: 32 Effective length of query: 404 Effective length of database: 403 Effective search space: 162812 Effective search space used: 162812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory