Align 3-isopropylmalate dehydratase large subunit; EC 4.2.1.33; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase (uncharacterized)
to candidate WP_013451188.1 CALNI_RS05335 aconitate hydratase AcnA
Query= curated2:Q97EE0 (422 letters) >NCBI__GCF_000183405.1:WP_013451188.1 Length = 877 Score = 140 bits (353), Expect = 2e-37 Identities = 108/349 (30%), Positives = 164/349 (46%), Gaps = 52/349 (14%) Query: 119 DVIIGADSHTCTYGALGVFSTGVGSTDMAVGMATGKAWFKVPEAIKFVLKGKPAKWVSGK 178 D IG DSHT +GV GVG + M + +PE I L G+ + V+ Sbjct: 203 DTCIGTDSHTPMVNGIGVMGWGVGGIEAEAVMLGQPYYMPIPEVIGVKLIGELNEGVTAT 262 Query: 179 DIILHIIGMIGVDGALYKSMEYTGDGLEYLSMDDRFTIANMAIEAGAKNGIFPVDEKTIE 238 D+IL I + G + K +EY G G++ LS+ DR TI+NM E GA GIFP+D KTIE Sbjct: 263 DLILTITEKLRRYGVVDKFVEYFGPGVKTLSIPDRATISNMTPEFGATLGIFPIDRKTIE 322 Query: 239 YMK-GRSDR-------ELKK----FDADEDAEYSRVIEIDLSTLKPTVAFPHLPENTKTI 286 Y++ DR KK + E EY+ V+EIDL++++P++A P P++ ++ Sbjct: 323 YLRMTNRDRYADILEIYAKKAGIFYTGQEKVEYTDVLEIDLNSIEPSIAGPSRPQDRISL 382 Query: 287 DQVG------------EVNVDQ------------VVIGSCTNGRMEDLRIAASILKGKKI 322 QV ++ +DQ I SCTN + I A ++ + Sbjct: 383 SQVKSNLQNLKTDNFVDIEIDQNPVRIKDGSVVIAAITSCTNTSNPFVIIGAGLMARNAV 442 Query: 323 KKGIRLIVF------PGTQNIYLEAMEEGLVRTFIEAGGIVSTPTCGPCLGGHMGILAEG 376 KKG+R+ + PG++ + + GL+ G ++ C C+G +L + Sbjct: 443 KKGLRVKPYVKTSFAPGSKVVESYLKKSGLMPYLEALGFHITAYGCTTCIGNSGPVLPQI 502 Query: 377 ERAI----------STTNRNFVGRMGHPKSEVYLASPAVAAASAIAGKI 415 E AI + NRNF R+ +LASP + A A+AGKI Sbjct: 503 EEAIIKNNLNVAAVLSGNRNFEARIHQLVRSNFLASPMLVVAYALAGKI 551 Lambda K H 0.317 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 853 Number of extensions: 46 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 422 Length of database: 877 Length adjustment: 37 Effective length of query: 385 Effective length of database: 840 Effective search space: 323400 Effective search space used: 323400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory