Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_013451661.1 CALNI_RS07780 aspartate aminotransferase family protein
Query= reanno::Koxy:BWI76_RS11670 (406 letters) >NCBI__GCF_000183405.1:WP_013451661.1 Length = 423 Score = 124 bits (312), Expect = 4e-33 Identities = 95/303 (31%), Positives = 150/303 (49%), Gaps = 29/303 (9%) Query: 18 YAPAAFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPRLVKALTEQAGKFWHTGNG 77 + P F+ R GS+++ G E ID G N LGHA+ +V + + + G Sbjct: 36 FPPFPFVVERAYGSKIFTIDGIELIDMWMGHYANILGHANGEIVAEICRVSSEGVQIG-- 93 Query: 78 YTNEPVLRLAKQLIDAT-FADRVFFCNSGAEANEAALKLARKYAHDRFGSEKSGIVAFKN 136 N L+LA+++ DA + + FC SG EA A ++++K+ + ++ I + Sbjct: 94 ILNRYQLQLAERIRDAVPEMELMRFCTSGTEATMYATRISKKF------TRRAVIAKIEG 147 Query: 137 AFHGRTLFTVSAGGQPAYSQDFAPLPPQIQHAIYNDLDSAKALID---DNTCAVIVEPMQ 193 +HG +S +P Y++ + + YNDL++A ++ D A+I+EP+ Sbjct: 148 GWHGGNT-DLSFDVKPPYNR----VKDDVLSIPYNDLETALDILHPFKDKVAAIILEPVL 202 Query: 194 GEGGVVPADADFLRGLRELCDAHNALLIFDEVQTGVG-RTGELYAYMHYGVTPDLLSTAK 252 G GG V A+ DFLRG+R CD + ALLIFDE TG R G ++ +GV PDL + K Sbjct: 203 GAGGGVAAELDFLRGIRRFCDENGALLIFDETITGFRFRFGSIWPI--FGVKPDLFTMGK 260 Query: 253 ALGGGFPIGALLASERCASVMTVG---THGTTYGGNPLACAVAGEVFATINTREVLNGVK 309 +GGGF IG + ++ G T G T+ +P+A A A + T E+L Sbjct: 261 IIGGGFAIGVYGGRKEIMQIIEKGDIITGGGTFSEHPVAMA------AGLKTLELLEKHD 314 Query: 310 QRH 312 H Sbjct: 315 YNH 317 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 423 Length adjustment: 31 Effective length of query: 375 Effective length of database: 392 Effective search space: 147000 Effective search space used: 147000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory