Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_013458940.1 SULKU_RS00365 2-hydroxyacid dehydrogenase
Query= BRENDA::O58256 (333 letters) >NCBI__GCF_000183725.1:WP_013458940.1 Length = 309 Score = 127 bits (320), Expect = 3e-34 Identities = 86/263 (32%), Positives = 138/263 (52%), Gaps = 8/263 (3%) Query: 46 IIVSPTTKITREVLENAERLKVISCHSAGYDNIDLEEATKRGIYVTKVSGLLSEAVAEFT 105 +IV+ I V+E+A LK+I + G +NID E A +RGI V V+G ++AV + T Sbjct: 45 VIVTNKVVINDAVMESAPNLKLICVAATGTNNIDHEAAKRRGIAVKNVAGYSTDAVVQHT 104 Query: 106 VGLIINLMRKIHYADKFIRRGEWESHAKIWTGFKRIESLYGKKVGILGMGAIGKAIARRL 165 ++ LM Y D++++ G W+ A L GK GI+G+G IG+ +AR Sbjct: 105 FSMLFYLMGHSRYYDEYVKSGAWQREAVFAHIGPSFSELRGKTWGIIGLGEIGRGVARVA 164 Query: 166 IPFGVKLYYWSRHRKVNVEKELKARYMDIDELLEKSDIVILALPLTRDTYHII-NEERVK 224 FG + Y+S K + + K + L+E SD++ + PL T ++I + E ++ Sbjct: 165 QAFGANVCYYSTSGKNDNGEYEKT---TLSRLIENSDVISIHAPLNASTENLISHSELLQ 221 Query: 225 KLEGKYLVNIGRGALVDEKAVTEAIKQGKLKGYATDVFEKEPVR-EHELF--KYEWETVL 281 +G L+N+GRG +VDE A++ I K DV KEP++ H L K+ + Sbjct: 222 MKDGAVLLNLGRGGIVDEDALS-VIIDVKPIFVGLDVLAKEPMKTSHPLLSVKHPERLYI 280 Query: 282 TPHYAGLALEAQEDVGFRAVENL 304 TPH A + EA+E + +EN+ Sbjct: 281 TPHIAWTSREARERLIASTIENI 303 Lambda K H 0.319 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 309 Length adjustment: 28 Effective length of query: 305 Effective length of database: 281 Effective search space: 85705 Effective search space used: 85705 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory