Align 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate WP_013459337.1 SULKU_RS02405 type II 3-dehydroquinate dehydratase
Query= BRENDA::Q48255 (167 letters) >NCBI__GCF_000183725.1:WP_013459337.1 Length = 158 Score = 170 bits (430), Expect = 1e-47 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 3/156 (1%) Query: 1 MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIID 60 MKI+VIQGPNLNML R+ ++YG + L+QIH M+ F Q +D+E F+Q+N EGEI+D Sbjct: 1 MKIVVIQGPNLNMLRVREQQVYGPMRLEQIHAQMKEFAAQNGVDIE--FYQSNLEGEIVD 58 Query: 61 KIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGA 120 +IQE G D +GIIINP A++HTSIAI DAI P IEVH++NI REEFR+ S T Sbjct: 59 RIQECYG-DADGIIINPAAYTHTSIAIRDAISAVSLPTIEVHISNIYRREEFRQKSMTAP 117 Query: 121 ACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQK 156 C I+GFGP GY++A+M M+ IL+E+ A ++AQ+ Sbjct: 118 VCTSSIIGFGPFGYHLAMMGMLQILSEINAMRQAQQ 153 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 97 Number of extensions: 3 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 167 Length of database: 158 Length adjustment: 18 Effective length of query: 149 Effective length of database: 140 Effective search space: 20860 Effective search space used: 20860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 43 (21.2 bits)
Align candidate WP_013459337.1 SULKU_RS02405 (type II 3-dehydroquinate dehydratase)
to HMM TIGR01088 (aroQ: 3-dehydroquinate dehydratase, type II (EC 4.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01088.hmm # target sequence database: /tmp/gapView.23819.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01088 [M=141] Accession: TIGR01088 Description: aroQ: 3-dehydroquinate dehydratase, type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-67 210.6 0.2 3.8e-67 210.4 0.2 1.0 1 lcl|NCBI__GCF_000183725.1:WP_013459337.1 SULKU_RS02405 type II 3-dehydroq Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000183725.1:WP_013459337.1 SULKU_RS02405 type II 3-dehydroquinate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 210.4 0.2 3.8e-67 3.8e-67 1 140 [. 2 141 .. 2 142 .. 0.99 Alignments for each domain: == domain 1 score: 210.4 bits; conditional E-value: 3.8e-67 TIGR01088 1 kilvlnGPnlnlLGkrepkvyGsltleeieelleeaakelevevevfqsnsegelidkihealeqvdgi 69 ki+v++GPnln+L re++vyG + le+i+++++e+a++++v++e++qsn ege++d+i+e+ +++dgi lcl|NCBI__GCF_000183725.1:WP_013459337.1 2 KIVVIQGPNLNMLRVREQQVYGPMRLEQIHAQMKEFAAQNGVDIEFYQSNLEGEIVDRIQECYGDADGI 70 699****************************************************************** PP TIGR01088 70 vinpaalthtsvalrDalaavslPvvevhlsnvhareefrkksvlaevakGvivGlGakgyklalealv 138 +inpaa+thts+a+rDa++avslP++evh+sn+++reefr+ks++a+v++ i+G+G+ gy+la++ ++ lcl|NCBI__GCF_000183725.1:WP_013459337.1 71 IINPAAYTHTSIAIRDAISAVSLPTIEVHISNIYRREEFRQKSMTAPVCTSSIIGFGPFGYHLAMMGML 139 ******************************************************************999 PP TIGR01088 139 ea 140 ++ lcl|NCBI__GCF_000183725.1:WP_013459337.1 140 QI 141 86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (141 nodes) Target sequences: 1 (158 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.18 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory