Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_013459502.1 SULKU_RS03225 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_000183725.1:WP_013459502.1 Length = 430 Score = 256 bits (655), Expect = 1e-72 Identities = 155/419 (36%), Positives = 229/419 (54%), Gaps = 13/419 (3%) Query: 374 LSRPIQKTSEIMHLVNPIIENVRDKGNSALLEYTEKFDGVKLSNPV---LNAPFPEEYFE 430 L R + +V +I+ +R G+SAL+ + KFD SN ++A + +E Sbjct: 19 LGRGKMDMEHVSSIVKGLIDEIRSDGDSALMTHIAKFDRWSPSNGAELRIDAADMKRAYE 78 Query: 431 GLTEEMKEALDLSIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPIEKVGLYIPGGTAI 490 L +K +L L+ + +R +H QLP + E G + + P+++ GLYIPGG A Sbjct: 79 ALDPTLKASLHLAYDRIRTYHEKQLPKSWFDTEAN-GTILGQKVTPVDRAGLYIPGGKAA 137 Query: 491 LPSTALMLGVPAQVAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGASKIVLAGGAQAVAA 550 PS+ LM +PAQVA + IV +P D + + ++ G +++ GGA A+AA Sbjct: 138 YPSSLLMNVIPAQVAGVEHIVVTTPT--PDNEPNELLLAACHLCGVTEVFKVGGASAIAA 195 Query: 551 MAYGTETIPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEDADVDF 610 MAYGTETIPKVD I GPGN FV AK V + +IDM AGPSE+ V+AD+ A+ Sbjct: 196 MAYGTETIPKVDVITGPGNIFVATAKKMVFGEV----NIDMIAGPSEIGVLADDSANPSH 251 Query: 611 VASDLLSQAEHGIDSQVILVGVNLSEKKIQEIQDAVHNQALQLPRVDIVRKCI-AHSTIV 669 +A DLLSQAEH D + + S+K + V +LPR +I RK I + I+ Sbjct: 252 IAIDLLSQAEH--DEMASSILITPSQKFAEACAAEVEVWLKKLPREEIARKSIDERAAII 309 Query: 670 LCDGYEEALEMSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPESCGDYSSGTNHT 729 + EEA++ N+ APEHL + N + + +AG++F+G YTPE+ GDY +G NHT Sbjct: 310 VTSSMEEAVKFMNEIAPEHLEVATDNPFALLPSIKHAGAIFLGHYTPEAIGDYVAGPNHT 369 Query: 730 LPTYGYARQYSGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRNAVKIRM 788 LPT G A+ YS F K + + + + + IG A +A EGL H +V+ R+ Sbjct: 370 LPTGGTAKFYSPLGVENFMKKSSIISFSRQAINEIGEACALIAHTEGLGAHEASVRCRL 428 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 745 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 430 Length adjustment: 37 Effective length of query: 762 Effective length of database: 393 Effective search space: 299466 Effective search space used: 299466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory