Align Aminodeoxychorismate/anthranilate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85; EC 4.1.3.27 (characterized)
to candidate WP_013459527.1 SULKU_RS03350 type 1 glutamine amidotransferase
Query= SwissProt::P28819 (194 letters) >NCBI__GCF_000183725.1:WP_013459527.1 Length = 189 Score = 227 bits (579), Expect = 9e-65 Identities = 112/188 (59%), Positives = 144/188 (76%), Gaps = 2/188 (1%) Query: 1 MILMIDNYDSFTYNLVQYLGELGEELVVKRNDSITIDEIEELSPDFLMISPGPCSPDEAG 60 MILMIDNYDSFTYN+VQY ELG +L + RND ++++EIE L P+ ++ISPGP +PD+AG Sbjct: 1 MILMIDNYDSFTYNIVQYCLELGADLKIIRNDEMSVEEIEALHPEKIIISPGPATPDDAG 60 Query: 61 ISLEAIKHFAGKIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKTSDIEHDGKT-IFEGLK 119 ++L+ I+HFA K+PI G+CLGHQSIAQ FGG+VVRA R+MHGKTS + +G+T IF L Sbjct: 61 VTLDVIRHFADKVPILGICLGHQSIAQAFGGNVVRAGRMMHGKTSKMVREGETPIFNKLP 120 Query: 120 NPLVATRYHSLIVKPETLPSCFTVTAQTKEG-EIMAIRHNDLPIEGVQFHPESIMTSFGK 178 ATRYHSLIV+ E LP TA +++ EIMA+ D PI GVQFHPESIM+ FG Sbjct: 121 EMFTATRYHSLIVEQENLPEVIIPTAYSEDDHEIMALEIKDKPIYGVQFHPESIMSEFGH 180 Query: 179 EMLRNFIE 186 E+L NF++ Sbjct: 181 EILNNFLK 188 Lambda K H 0.320 0.139 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 194 Length of database: 189 Length adjustment: 20 Effective length of query: 174 Effective length of database: 169 Effective search space: 29406 Effective search space used: 29406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
Align candidate WP_013459527.1 SULKU_RS03350 (type 1 glutamine amidotransferase)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00566.hmm # target sequence database: /tmp/gapView.31147.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00566 [M=192] Accession: TIGR00566 Description: trpG_papA: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-80 253.8 0.1 5.9e-80 253.6 0.1 1.0 1 lcl|NCBI__GCF_000183725.1:WP_013459527.1 SULKU_RS03350 type 1 glutamine a Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000183725.1:WP_013459527.1 SULKU_RS03350 type 1 glutamine amidotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 253.6 0.1 5.9e-80 5.9e-80 1 191 [. 1 188 [. 1 189 [] 0.97 Alignments for each domain: == domain 1 score: 253.6 bits; conditional E-value: 5.9e-80 TIGR00566 1 mvllidnydsftynlvqlleelgaevvvkrndsltlqeieallpllsivisPGPctPdeaaisslelie 69 m+l+idnydsftyn+vq+ elga++ + rnd++ ++eieal p++ i+isPGP+tPd+a++ l++i+ lcl|NCBI__GCF_000183725.1:WP_013459527.1 1 MILMIDNYDSFTYNIVQYCLELGADLKIIRNDEMSVEEIEALHPEK-IIISPGPATPDDAGVT-LDVIR 67 89********************************************.****************.***** PP TIGR00566 70 hlaGklPilGvClGhqalaqafGadvvraekvkhGkvseiehngaavfaglfn..Pdalkatryhslvv 136 h+a k+PilG+ClGhq++aqafG++vvra +++hGk+s++ +g++ ++fn P+ ++atryhsl+v lcl|NCBI__GCF_000183725.1:WP_013459527.1 68 HFADKVPILGICLGHQSIAQAFGGNVVRAGRMMHGKTSKMVREGET---PIFNklPEMFTATRYHSLIV 133 *******************************************975...444444888*********** PP TIGR00566 137 eaetldtllevtaleeeeieimairhrdlpleGvqfhPesilselGkellanflk 191 e e+l++++ ta +e ++eima+ +d+p+ GvqfhPesi+se+G+e+l+nflk lcl|NCBI__GCF_000183725.1:WP_013459527.1 134 EQENLPEVIIPTAYSEDDHEIMALEIKDKPIYGVQFHPESIMSEFGHEILNNFLK 188 *****************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (192 nodes) Target sequences: 1 (189 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.80 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory