Align N-acetylglutamate synthase (EC 2.3.1.1) (characterized)
to candidate WP_013460285.1 SULKU_RS07180 GNAT family N-acetyltransferase
Query= reanno::DvH:207038 (154 letters) >NCBI__GCF_000183725.1:WP_013460285.1 Length = 153 Score = 95.9 bits (237), Expect = 3e-25 Identities = 51/147 (34%), Positives = 86/147 (58%), Gaps = 3/147 (2%) Query: 6 RKATVPDVKRIHAILMECAGQRLLLPRSLNDLYSRIRDFVVVDADEGGAILGCCALSITW 65 +K T+ D+ + ++ ++LPRS +++ + IR + + A +G ++G AL I Sbjct: 6 KKPTLLDIPAMQQLVAPEIESGVILPRSNDEIATNIRSYFL--ALDGEKLVGFVALHIHS 63 Query: 66 EDIAEIRSLVVLESLRGQGWGRRLVEACMSDAVTLGLYRVFTLTYQVEFFNKLGYSVVGK 125 +AE+RS+++ + RG+ G LVE + LGL V LTYQ FF +LG+ + K Sbjct: 64 PALAELRSMIIDTAYRGRNIGTTLVENACEEGRRLGLKEVLALTYQQRFFERLGFVEIPK 123 Query: 126 EVLPQ-KVWADCIHCPQFPECDETAML 151 E +P+ K+WADCI C FP C+E +++ Sbjct: 124 ESIPEHKIWADCIKCKHFPVCNEVSLI 150 Lambda K H 0.327 0.142 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 75 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 154 Length of database: 153 Length adjustment: 17 Effective length of query: 137 Effective length of database: 136 Effective search space: 18632 Effective search space used: 18632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory