Align histidinol-phosphate aminotransferase; tyrosine/phenylalanine aminotransferase (promiscuous) (EC 2.6.1.1; EC 2.6.1.9) (characterized)
to candidate WP_013460776.1 SULKU_RS09625 histidinol-phosphate transaminase
Query= metacyc::BSU22620-MONOMER (360 letters) >NCBI__GCF_000183725.1:WP_013460776.1 Length = 364 Score = 241 bits (616), Expect = 2e-68 Identities = 133/362 (36%), Positives = 210/362 (58%), Gaps = 10/362 (2%) Query: 1 MRIKEHLKQLKPYQPGKPIEAVKSEYGLDK--VVKLASNENPYGCSEAAKEALHHEIQQL 58 M+ L+ +K Y+ GKPIE V EYG+DK +VKLASNENP+GCS K+A+ I + Sbjct: 1 MKFNTALESIKTYEAGKPIELVVREYGIDKDQIVKLASNENPFGCSPKVKDAVRAIIDNM 60 Query: 59 ALYPDGYSAALRTRLSKHLNVSETSLIFGNGSDEIIQIICRAFLNDKTNTVTAAPTFPQY 118 ALYPD L++ LS + LI G GSD++I+ A + + + + TF Y Sbjct: 61 ALYPDDSMVKLKSALSNKYGIQSNELIIGAGSDQVIEFAIHAKAHSGSKVLMNSVTFAMY 120 Query: 119 KHNAVIEGAEVREIALRPDGSHDLDAMLEAIDEQTQVVWICSPNNPTGTYTSEGELLAFL 178 + A GA++ A R + A+ + + + ++++C+PNNPTG EL++F+ Sbjct: 121 EIYAKQVGAQIIRTASREHKMDEFYALYQ--EHKPSIIFLCTPNNPTGDGLLASELVSFI 178 Query: 179 ERVPSRVLVVLDEAYYEYVTAEDYPETVP---LLSKYSNLMILRTFSKAYGLAALRVGYG 235 E++ + LV++D AY EY +D V L+ +++N++ L TFSKAYGL +RVGYG Sbjct: 179 EKIDNDTLVIVDGAYMEYARFKDPSYAVEPGDLVKRFNNVLFLGTFSKAYGLGGMRVGYG 238 Query: 236 IADENLIRQIEPAREPFNTSRLGQAAAIAALDDQAFIASCVEQNNAGLQQYYDFAKTHGL 295 IA +I + R PFN + L AA AL+D+ F+ C+ N + +++Y +FA G+ Sbjct: 239 IACAPIIEALYKVRPPFNITTLSLEAASVALEDELFVQECIADNFSQMERYKEFAHAKGI 298 Query: 296 KCYPSQTNFV--LIDFKRPADELFQALLEKGYIVRSGNALGFPTSLRITIGTKEQNEEIL 353 S TNFV L+ ++ + ++ Q LL+KG IVR ++ G ++R+TIGT+ QN+ Sbjct: 299 TVIESYTNFVTLLLPEEKNSSKIAQELLKKGMIVRDLSSYGL-NAIRVTIGTRVQNDRFF 357 Query: 354 AI 355 + Sbjct: 358 EL 359 Lambda K H 0.317 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 15 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 364 Length adjustment: 29 Effective length of query: 331 Effective length of database: 335 Effective search space: 110885 Effective search space used: 110885 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory