Align Putative asparagine synthetase [glutamine-hydrolyzing] 2; EC 6.3.5.4 (uncharacterized)
to candidate WP_013461234.1 SULKU_RS11960 asparagine synthase (glutamine-hydrolyzing)
Query= curated2:Q58456 (515 letters) >NCBI__GCF_000183725.1:WP_013461234.1 Length = 601 Score = 182 bits (462), Expect = 3e-50 Identities = 127/395 (32%), Positives = 197/395 (49%), Gaps = 38/395 (9%) Query: 1 MCGINGII-RFGKEVIKEEINKMNKAIKHRGPDDEGIFIYNFKNYSIGLGHVRLAILDLS 59 MCG+ GII + +E + K ++HRG D G+ N ++ L H RL+I D+ Sbjct: 1 MCGVFGIIGHYSPHKAREAL----KTLQHRGRDYCGVVEQN----TLFLAHQRLSITDVH 52 Query: 60 EKGHQPMGYNVDEDKIIYRDDELDRADIIIVYNGEIYNYLELKEKFN-LETETGTDTEVI 118 + HQPM R D+L +I +NGEIYN+ L+E+ L+ ET +DTEV+ Sbjct: 53 PRSHQPM-----------RRDKL-----LISFNGEIYNHARLREQLTGLKWETSSDTEVV 96 Query: 119 LKLYNKLGFDCVKEFNGMWAFCIFDKKKGLIFCSRDRLGVKPFYYYWDGNEFIFSSELKG 178 L Y + G CV+ GM+AF + D K + RDR G KP +Y+ F+F SE+K Sbjct: 97 LAAYERWGIRCVEYLEGMFAFALIDGDK--CYLVRDRFGKKPLFYHQSNEAFVFGSEIK- 153 Query: 179 ILAVKEINKKENINKDAVELYFALGFIPSPYSIYKNTFKLEARQNLIFDLDKREIRKYY- 237 A+K +N +A+ Y + P++ YK KLE+ + L + K +YY Sbjct: 154 --AIKPFLSSVYMNDEALHSYLSFLAPTPPHTFYKGIEKLESGEWLCAEQGKITKHRYYN 211 Query: 238 YWELPDYKPIYDKKKLIEEGKKLLYDAVKIRMRSDVPVGAFLSGGLDSSTVVGVMREFTD 297 + PD I + ++ L+ A+ +R+ ++VP+ A LSGGLDS+ + + Sbjct: 212 LLDTPD-SSITGNSDALYRIEEELHRAIAVRLDTEVPIAALLSGGLDSAMICAIAAR--Q 268 Query: 298 LSKLHTFSIGFE--GKYDETPYIKIVVDYFKTQHHHYYFKERDFEELIDKYSWIYDEPFG 355 KL F++G+ YDE + Y H + DF+E +D+ DEP Sbjct: 269 GKKLPVFTLGYNEYDAYDERKNAAMTAKYLGLDHTEVIISQNDFDEHLDELLTHMDEPLN 328 Query: 356 DYSGFPTY-KVSEMARKFVTVVLSGDGGDEVFGGY 389 D + P Y + ++ + VVLSG+G DE+F GY Sbjct: 329 DPAALPLYLLMKKIGAEGYKVVLSGEGSDELFLGY 363 Lambda K H 0.322 0.144 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 825 Number of extensions: 54 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 601 Length adjustment: 36 Effective length of query: 479 Effective length of database: 565 Effective search space: 270635 Effective search space used: 270635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)
Align candidate WP_013461234.1 SULKU_RS11960 (asparagine synthase (glutamine-hydrolyzing))
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.12478.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-130 422.2 0.0 2.2e-130 422.0 0.0 1.0 1 lcl|NCBI__GCF_000183725.1:WP_013461234.1 SULKU_RS11960 asparagine synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000183725.1:WP_013461234.1 SULKU_RS11960 asparagine synthase (glutamine-hydrolyzing) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 422.0 0.0 2.2e-130 2.2e-130 1 517 [] 2 538 .. 2 538 .. 0.86 Alignments for each domain: == domain 1 score: 422.0 bits; conditional E-value: 2.2e-130 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkdekeenailghrRLaiidlseg.aQPlsne 68 Cg++gi+ ++ ++++e l+tl+hRG D gv + ++ l+h+RL+i+d++ +QP++ + lcl|NCBI__GCF_000183725.1:WP_013461234.1 2 CGVFGIIGHYSP-----HKAREALKTLQHRGRDYCGVVE---QNTLFLAHQRLSITDVHPRsHQPMRRD 62 *********886.....445666889**********744...5899*************999******9 PP TIGR01536 69 kevvivfnGEIYNheeLreeleekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekkgelf 137 k +i fnGEIYNh Lre+l G ++et sDtEV+Laaye wg ++ve+LeGmFAfal+d ++ + lcl|NCBI__GCF_000183725.1:WP_013461234.1 63 K-LLISFNGEIYNHARLREQLT--GLKWETSSDTEVVLAAYERWGIRCVEYLEGMFAFALIDG--DKCY 126 9.79*****************9..89*************************************..9*** PP TIGR01536 138 laRDrlGikPLYyaseqgkllfaSEiKallalkeikaeldkealaelltlqlvptektlfkevkelepa 206 l+RDr+G+kPL+y + +++++f+SEiKa+ ++ + +++eal+++l++ ++++t++k++++le + lcl|NCBI__GCF_000183725.1:WP_013461234.1 127 LVRDRFGKKPLFYHQSNEAFVFGSEIKAIKPFL-SSVYMNDEALHSYLSFLAPTPPHTFYKGIEKLESG 194 *********************************.699**************999*************** PP TIGR01536 207 kal...dgeekleeywevekee..vkeseeelveelrelledavkkrlvadvpvgvllSGGlDSslvaa 270 + l +g+ ++++y+++ ++ + +++ +++e l++a++ rl ++vp+++llSGGlDS +++a lcl|NCBI__GCF_000183725.1:WP_013461234.1 195 EWLcaeQGKITKHRYYNLLDTPdsSITGNSDALYRIEEELHRAIAVRLDTEVPIAALLSGGLDSAMICA 263 *9997666677777998877665644557788999********************************** PP TIGR01536 271 iakkeaksevktFsigfedskdldeskaarkvadelgtehkevliseeevlkeleevilaleeptaira 339 ia+++ k ++ +F++g+++ +++de k a+ +a++lg++h+ev+is++++ ++l+e++ +++ep++++a lcl|NCBI__GCF_000183725.1:WP_013461234.1 264 IAARQGK-KLPVFTLGYNEYDAYDERKNAAMTAKYLGLDHTEVIISQNDFDEHLDELLTHMDEPLNDPA 331 *****88.8************************************************************ PP TIGR01536 340 siplyllsklarekgvkVvLsGeGaDElfgGYeyfreakaeeale.............lpeaselaekk 395 + plyll+k++ ++g+kVvLsGeG+DElf GY ++e+ e++ lcl|NCBI__GCF_000183725.1:WP_013461234.1 332 ALPLYLLMKKIGAEGYKVVLSGEGSDELFLGYRQYFEYLDIEKAAslhhknwlkkyfhS---------- 390 ***********************************999888877745554444444330.......... PP TIGR01536 396 l....................llqaklakeselkellkakleeelkek.....eelkkelkeeseleel 439 + +++ ++ ++++l++++++++ + + +++++++++e+ lcl|NCBI__GCF_000183725.1:WP_013461234.1 391 HfsmnrewewykrifddtllfRTSGDKFTDLQQNKLFRRNVRDNESLRflesyRRMFEQSAHEHPSVWY 459 034445555666667777777444444444455555555555544433000004444444444555556 PP TIGR01536 440 lrldlelllsdllrak.DrvsmahslEvRvPflDkelvelalsippelklrdgkeKvlLreaaeellPe 507 dl+l++ + + k Drvsmah +E+R PflD+ l+e++ls++p+l++ +g +K lL+++a+++l + lcl|NCBI__GCF_000183725.1:WP_013461234.1 460 SMIDLKLFVGEHFLTKlDRVSMAHTIEARTPFLDHILAETVLSVDPSLRIGNGGTKPLLKQIARNYLSD 528 67789999999999999**************************************************** PP TIGR01536 508 eileRkKeaf 517 ei +RkK++f lcl|NCBI__GCF_000183725.1:WP_013461234.1 529 EIITRKKKGF 538 ********98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (601 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 13.93 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory