Align asparagine synthase (glutamine-hydrolysing) 1; EC 6.3.5.4 (characterized)
to candidate WP_013461241.1 SULKU_RS11995 asparagine synthase (glutamine-hydrolyzing)
Query= CharProtDB::CH_005185 (632 letters) >NCBI__GCF_000183725.1:WP_013461241.1 Length = 552 Score = 224 bits (570), Expect = 1e-62 Identities = 169/569 (29%), Positives = 274/569 (48%), Gaps = 44/569 (7%) Query: 1 MCGFVGVFNKHPLAQTADQEELIKQMNQMIVHRGPDSDGYFHDEHVGFGFRRLSIIDVEN 60 MCG G +K+ + + ++++++M VHRGPD G + G RLSIID Sbjct: 1 MCGIAGFISKN---KDYNAQKIVQEMLDRGVHRGPDQSGLATYQDTTIGMVRLSIIDTVE 57 Query: 61 GGQPLSYEDETYWIIFNGEIYNYIELREELEAKGYTFNTDSDTEVLLATYRHYKEEAASK 120 P + I++NGEIYN+ E+R+ L K YTF T+SDTE + ++ A + Sbjct: 58 HTIPYEDSSGNFAIVYNGEIYNHQEIRKNL--KYYTFLTNSDTETAMVSFIDKGINAFKE 115 Query: 121 LRGMFAFLIWNKNDHVLYGARDPFGIKPLYYTTINDQVYFASERKSLMVAQNDIEIDKEA 180 GM+AF + +K + Y RD G KPLYY D FASE KSLM DK Sbjct: 116 YNGMYAFALHDKKKNETYIVRDKVGEKPLYYVKTKDFFAFASEIKSLMGLVEPKLNDKAV 175 Query: 181 LQQYMSFQFVPEPSTLDAHVKKVEPGSQFTIRPDGDITFKTYFKANFKPVQT--EEDKLV 238 Y +++F TL + +EPG ++ + T K+Y+K P+ E K++ Sbjct: 176 --SYRAYEFTTGKETLFKDIYLLEPGEYIHVK-NNKATIKSYWKIWDHPIDVPDNEAKIL 232 Query: 239 KEVRDAIYDSVNVHMRSDV-PVGSFLSGGIDSSFIVSVAKEFHPSLKTFSVGFEQQGFSE 297 + + + DS+ + ++ G+F+SGGIDSS + +AK H ++ ++ F+E Sbjct: 233 SSLAELVEDSILLRTQNSAHAFGAFVSGGIDSSLVACIAKPDH----LYTAHYDYSDFNE 288 Query: 298 VDVAKETAAALGIENISKVISPEEYMNELPKIVWHFDDPLADPAAIPLYFVAKEAKKHVT 357 +D AK A L + I + ++++ +I +H D P + + + ++ + Sbjct: 289 LDYAKLVAKQLKKKLIIVEPTKDDFLRTQEQIAYHLDTPCTWTSFTLWALMERISQDGLK 348 Query: 358 VALSGEGADELFGGYNIYREPLSLKPFERIPSGLKKMLLHVAAVMPEGMRGKSLLERGCT 417 V L+G+GADE+FGGY+ Y L E+I H M E L+ R Sbjct: 349 VMLTGDGADEVFGGYHRYH---LLHHDEQI---------HTLEAMKE---YSYLINRYYG 393 Query: 418 PLQDRYIGNAKIFEESVKKQLLKHYNPNLSYRDVTKTYFTESSSYSDINKMQYVDIHTWM 477 +RY E ++LK N ++ + YF E ++ M D ++ M Sbjct: 394 SPVERYTKLVNRSENPYDTKVLKFLNESIGF------YF-EKMQKDVVHAMGLNDFYSTM 446 Query: 478 RGDILLKADKMTMANSLELRVPFLDKVVFDVASKIPDELKTKNGTTKYLLRKAAEGIVPE 537 + +L +D+++MA S+E R PFLD + A +P + K KNG TK+ L++ A +P+ Sbjct: 447 Q-VLLQMSDRVSMAFSIENRSPFLDYRLIQFAFSMPSKYKIKNGITKWALKEVARKFIPK 505 Query: 538 HVLNR-KKLGFPVPIRHWLKNEMNEWVRN 565 + +R K GF P+ W EW +N Sbjct: 506 EICDRVDKRGFSAPVNKWF-----EWDKN 529 Lambda K H 0.319 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 875 Number of extensions: 51 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 632 Length of database: 552 Length adjustment: 37 Effective length of query: 595 Effective length of database: 515 Effective search space: 306425 Effective search space used: 306425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
Align candidate WP_013461241.1 SULKU_RS11995 (asparagine synthase (glutamine-hydrolyzing))
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.4802.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-120 389.6 0.9 1.6e-120 389.4 0.9 1.0 1 lcl|NCBI__GCF_000183725.1:WP_013461241.1 SULKU_RS11995 asparagine synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000183725.1:WP_013461241.1 SULKU_RS11995 asparagine synthase (glutamine-hydrolyzing) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 389.4 0.9 1.6e-120 1.6e-120 1 517 [] 2 516 .. 2 516 .. 0.87 Alignments for each domain: == domain 1 score: 389.4 bits; conditional E-value: 1.6e-120 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkdekeenailghrRLaiidlsegaQPlsnek 69 Cgiag++ ++++ + + + ++eml++ hRGPD++g+ + ++ +g +RL+iid e + P ++ + lcl|NCBI__GCF_000183725.1:WP_013461241.1 2 CGIAGFISKNKDYNAQ-KIVQEMLDRGVHRGPDQSGLATY---QDTTIGMVRLSIIDTVEHTIPYEDSS 66 *********9988775.9******************7555...899*********************** PP TIGR01536 70 .evvivfnGEIYNheeLreeleekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekkgelf 137 + +iv+nGEIYNh+e+r++l+ y+F t+sDtE + ++ g +++++ +Gm+Afal+d+kk+e + lcl|NCBI__GCF_000183725.1:WP_013461241.1 67 gNFAIVYNGEIYNHQEIRKNLK--YYTFLTNSDTETAMVSFIDKGINAFKEYNGMYAFALHDKKKNETY 133 999******************9..47******************************************* PP TIGR01536 138 laRDrlGikPLYyaseqgkllfaSEiKallalkeikaeldkealaelltlqlvptektlfkevkelepa 206 ++RD++G kPLYy ++++ ++faSEiK+l+ l +++l+++a++ + ++++++ ++tlfk+++ lep+ lcl|NCBI__GCF_000183725.1:WP_013461241.1 134 IVRDKVGEKPLYYVKTKDFFAFASEIKSLMGLV--EPKLNDKAVS-YRAYEFTTGKETLFKDIYLLEPG 199 *******************************98..6777776654.5555556899************* PP TIGR01536 207 kal...dgeekleeywevekee..vkeseeelveelrelledavkkrlv.advpvgvllSGGlDSslva 269 ++ ++++++++yw++ ++ v ++e + ++l el+ed++ r + g+++SGG+DSslva lcl|NCBI__GCF_000183725.1:WP_013461241.1 200 EYIhvkNNKATIKSYWKIWDHPidVPDNEAKILSSLAELVEDSILLRTQnSAHAFGAFVSGGIDSSLVA 268 *9977777777788****99986677889999***************98788999************** PP TIGR01536 270 aiakkeaksevktFsigfedskdldeskaarkvadelgtehkevliseeevlkeleevilaleeptair 338 +iak ++++ +++ +d++e ++a+ va++l ++ v+ +++++l e++ ++l+ p + lcl|NCBI__GCF_000183725.1:WP_013461241.1 269 CIAKPD-----HLYTAHYD-YSDFNELDYAKLVAKQLKKKLIIVEPTKDDFLRTQEQIAYHLDTPCTW- 330 ****99.....88*****9.9*********************************************65. PP TIGR01536 339 asiplyllsklarekgvkVvLsGeGaDElfgGYeyfreakaeealelpeaselaekklllqaklak... 404 s++l++l+++++++g+kV+L+G+GaDE+fgGY++++ + +e++++ ea++ e + l+++++ + lcl|NCBI__GCF_000183725.1:WP_013461241.1 331 TSFTLWALMERISQDGLKVMLTGDGADEVFGGYHRYHLLHHDEQIHTLEAMK--EYSYLINRYYGSpve 397 6789*****************************************9555554..333333333322000 PP TIGR01536 405 .eselkellkakleeelkekeelkkelkee..........seleellrldlelllsdllrakDrvsmah 462 ++l + + +++++ + l++ + ++++ +d+ ++ ll+++Drvsma lcl|NCBI__GCF_000183725.1:WP_013461241.1 398 rYTKLVNRSENPYDTKV--LKFLNE----SigfyfekmqkDVVHAMGLNDFYSTMQVLLQMSDRVSMAF 460 02222222222222222..222222....2222243344467788888999****************** PP TIGR01536 463 slEvRvPflDkelvelalsippelklrdgkeKvlLreaaeellPeeileR.kKeaf 517 s+E R PflD +l+++a+s+p ++k+++g +K+ L+e+a++ +P+ei +R +K++f lcl|NCBI__GCF_000183725.1:WP_013461241.1 461 SIENRSPFLDYRLIQFAFSMPSKYKIKNGITKWALKEVARKFIPKEICDRvDKRGF 516 *****************************************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (552 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 11.90 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory