Align histidinol-phosphate aminotransferase (EC 2.6.1.9) (characterized)
to candidate WP_013518089.1 ALIDE2_RS18250 histidinol-phosphate transaminase
Query= reanno::psRCH2:GFF3234 (348 letters) >NCBI__GCF_000204645.1:WP_013518089.1 Length = 360 Score = 410 bits (1054), Expect = e-119 Identities = 217/349 (62%), Positives = 259/349 (74%), Gaps = 7/349 (2%) Query: 6 SPFVKDLVPYVPGEQPKLSKLVKLNTNENPYGPSPRAIAAMQAELNDSLRLYPDPNGERL 65 SP V L PYVPGEQP+++ LVKLNTNENPY PSPRA+AA++A + L+LYPDP L Sbjct: 8 SPVVGRLEPYVPGEQPRIAGLVKLNTNENPYPPSPRAVAAIEAAAREGLQLYPDPQSLAL 67 Query: 66 KQAVADYYGVQPAQVFVGNGSDEVLAHAFHGLFQHAG-PLLFPDISYSFYPVYCGLYGIA 124 ++ +A ++G++ QVFVGNGSDEVLAHAF FQHAG PLL PDI+YSFY VYC L+GIA Sbjct: 68 RETIAAHHGLEAGQVFVGNGSDEVLAHAFFAFFQHAGQPLLMPDITYSFYRVYCRLWGIA 127 Query: 125 YETVALDEQFQIDVADY-----NRPNGGIIFPNPNAPTGCLLALEAIERLLQANTETVVL 179 E LDE IDV GI+ NPNAPTG L L IERLL A + VVL Sbjct: 128 PELQPLDEGLAIDVERIAARAAEGACAGIVLANPNAPTGMGLPLSQIERLLAACPQRVVL 187 Query: 180 VDEAYVDFGGESAIALVDRYPNLLVTQTLSKSRSLAGLRVGLAVGHPDLIEALERIKNSF 239 VDEAYVDFGGESA++LV RYPNLLV TLSKSRSLAGLRVG A G LI+ALER+K+SF Sbjct: 188 VDEAYVDFGGESAVSLVPRYPNLLVVHTLSKSRSLAGLRVGAAFGQRPLIDALERVKDSF 247 Query: 240 NSYPLDRIAIAGAAAAFEDRAYFQQTCQQVIDSREAVVAAMQGLGFEVLPSAANFIFARH 299 NSYPLDR+A AGA AA+ED AYF +T + V+ SRE + A++ LGFEVLPS ANF+F RH Sbjct: 248 NSYPLDRLAQAGARAAYEDVAYFDETRRAVMHSREGLALALEDLGFEVLPSQANFLFVRH 307 Query: 300 PQRDAATIAASLREQGVIVRHF-KQRRIEQFLRITIGTPEQNQALLEAL 347 P D A +AA+LRE+ V+VRHF + RI Q+LRI++GTP Q AL+ AL Sbjct: 308 PAHDGARLAAALRERAVLVRHFARPERIAQYLRISVGTPAQCDALVRAL 356 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 456 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 360 Length adjustment: 29 Effective length of query: 319 Effective length of database: 331 Effective search space: 105589 Effective search space used: 105589 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_013518089.1 ALIDE2_RS18250 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.5258.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-88 281.2 0.0 5.6e-88 281.1 0.0 1.0 1 lcl|NCBI__GCF_000204645.1:WP_013518089.1 ALIDE2_RS18250 histidinol-phosph Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000204645.1:WP_013518089.1 ALIDE2_RS18250 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 281.1 0.0 5.6e-88 5.6e-88 4 348 .. 11 358 .. 8 359 .. 0.94 Alignments for each domain: == domain 1 score: 281.1 bits; conditional E-value: 5.6e-88 TIGR01141 4 ikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk.klhrYpdpqalelkealakylgve 71 + lepY+pg++ + + vkLn+nEnP++ps+++++a++++++ l++Ypdpq+l+l+e++a++ g+e lcl|NCBI__GCF_000204645.1:WP_013518089.1 11 VGRLEPYVPGEQPR-IAGLVKLNTNENPYPPSPRAVAAIEAAAReGLQLYPDPQSLALRETIAAHHGLE 78 6789*****95554.448***********************99889*********************** PP TIGR01141 72 eenillgnGsdelielliraflepg.davlvleptysmYevsakiagaevkevplkedgqedleavle. 138 + ++++gnGsde++ + af + + l+++ tys Y+v+ ++ g+ pl+e d+e +++ lcl|NCBI__GCF_000204645.1:WP_013518089.1 79 AGQVFVGNGSDEVLAHAFFAFFQHAgQPLLMPDITYSFYRVYCRLWGIAPELQPLDEGLAIDVERIAAr 147 ***************99999988777********************************98999999986 PP TIGR01141 139 aakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlvvlrT 207 aa+ + la+Pn+PtG l ++ie++l++ + +V+vDeAY++F +e s+++l+ +ypnl+v+ T lcl|NCBI__GCF_000204645.1:WP_013518089.1 148 AAEGACAGIVLANPNAPTGMGLPLSQIERLLAACPQRVVLVDEAYVDFGGE-SAVSLVPRYPNLLVVHT 215 7777788899***********************989**************7.***************** PP TIGR01141 208 lSKafgLAglRvGyaianaeiiealekvrapyn...vsslaleaavaalrdsdkiektveevkkererl 273 lSK+ +LAglRvG a+++ +i+ale+v++++n +++la++ a aa++d +++ +t ++v ++re l lcl|NCBI__GCF_000204645.1:WP_013518089.1 216 LSKSRSLAGLRVGAAFGQRPLIDALERVKDSFNsypLDRLAQAGARAAYEDVAYFDETRRAVMHSREGL 284 *****************************87543339******************************** PP TIGR01141 274 leelkkleglevyeSkaNFvlikvke.daeelleallekgiivRdlksaeglleeclRitvGtreener 341 +l++l g+ev +S+aNF++++ ++ d ++l+ al e+ ++vR+++ e + ++lRi+vGt+ ++++ lcl|NCBI__GCF_000204645.1:WP_013518089.1 285 ALALEDL-GFEVLPSQANFLFVRHPAhDGARLAAALRERAVLVRHFARPE-RIAQYLRISVGTPAQCDA 351 *******.8***************99999*****************9875.68**************** PP TIGR01141 342 llealke 348 l++al+ lcl|NCBI__GCF_000204645.1:WP_013518089.1 352 LVRALQA 358 ****986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (360 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.35 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory