Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_013518766.1 ALIDE2_RS10590 chorismate synthase
Query= SwissProt::P12008 (361 letters) >NCBI__GCF_000204645.1:WP_013518766.1 Length = 364 Score = 461 bits (1186), Expect = e-134 Identities = 225/359 (62%), Positives = 275/359 (76%), Gaps = 1/359 (0%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 M+GNT+G LF VT FGESHG A+GC++DG PPG+ L EAD+Q DLDRRRPGTSR+ TQR Sbjct: 1 MSGNTLGTLFCVTNFGESHGPAIGCVIDGCPPGMALCEADIQADLDRRRPGTSRHVTQRN 60 Query: 61 EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120 EPD V+ILSGV+EG TTGT I LLI N DQRS+DY I FRPGHADY Y KYGLRD Sbjct: 61 EPDAVEILSGVYEGRTTGTPIALLIRNQDQRSKDYGDIAQSFRPGHADYAYWHKYGLRDP 120 Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFC 180 RGGGRSSAR TA VAAGA+AKK+LAE +G R C+ Q+G++P+ ++W V NPFF Sbjct: 121 RGGGRSSARLTAPTVAAGAVAKKWLAETYGTRFRACMAQLGELPIPFENWEHVPNNPFFA 180 Query: 181 PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV 240 P D + A ++ M AL+K GDS GA++ V A+GVP GLGEP++D+LDADIAHA+M +NAV Sbjct: 181 PVAD-VQAYEDYMDALRKSGDSCGARLRVQATGVPVGLGEPLYDKLDADIAHAMMGLNAV 239 Query: 241 KGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITV 300 KGVEIG GF VA RG+ + D +T GF N+AGG+LGGIS+GQ I +A+KPTSSI Sbjct: 240 KGVEIGAGFASVAQRGTTHGDSLTPQGFAGNNAGGVLGGISTGQDIEVQLAIKPTSSIIS 299 Query: 301 PGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADVKTDIP 359 P +I+ G E++T+GRHDPCVGIRA PIAEA+LA+VLMDH LRQRAQ DV+ +P Sbjct: 300 PRESIDVHGRSTEVVTRGRHDPCVGIRAAPIAEALLALVLMDHALRQRAQCGDVRQAVP 358 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 471 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 364 Length adjustment: 29 Effective length of query: 332 Effective length of database: 335 Effective search space: 111220 Effective search space used: 111220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_013518766.1 ALIDE2_RS10590 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.16231.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-133 430.9 0.0 2e-133 430.6 0.0 1.0 1 lcl|NCBI__GCF_000204645.1:WP_013518766.1 ALIDE2_RS10590 chorismate syntha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000204645.1:WP_013518766.1 ALIDE2_RS10590 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 430.6 0.0 2e-133 2e-133 2 350 .. 11 349 .. 10 350 .. 0.97 Alignments for each domain: == domain 1 score: 430.6 bits; conditional E-value: 2e-133 TIGR00033 2 rlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtGa 70 +t fGeSHg+a+g++idG+P+g+ l e+diq +l+rRrpg+sr+ ++r+E D+veilsGv+eG+TtG+ lcl|NCBI__GCF_000204645.1:WP_013518766.1 11 CVTNFGESHGPAIGCVIDGCPPGMALCEADIQADLDRRRPGTSRHVTQRNEPDAVEILSGVYEGRTTGT 79 6899***************************************************************** PP TIGR00033 71 PiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLket 139 Pialli+N+d+rskdy di++++RPgHady+y++KYg++d +gggrsSaR Ta vaaGavakk+L+et lcl|NCBI__GCF_000204645.1:WP_013518766.1 80 PIALLIRNQDQRSKDYGDIAQSFRPGHADYAYWHKYGLRDPRGGGRSSARLTAPTVAAGAVAKKWLAET 148 ********************************************************************* PP TIGR00033 140 agieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvvs 208 +g++ a + +lge+ +++e+ e++ ++p+++p a+ ++ e+++d ++k+gds G+++ v+++ lcl|NCBI__GCF_000204645.1:WP_013518766.1 149 YGTRFRACMAQLGELPIPFEN-----WEHVPNNPFFAPVAD-VQAYEDYMDALRKSGDSCGARLRVQAT 211 ******************855.....557999999999865.5679*********************** PP TIGR00033 209 nvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGie 277 +vpvglGepl+dklda +a+a++++nAvKgveiG+GF+++ +rG + D + + + nn GG++ lcl|NCBI__GCF_000204645.1:WP_013518766.1 212 GVPVGLGEPLYDKLDADIAHAMMGLNAVKGVEIGAGFASVAQRGTTHGDS----LTPQGFAGNNAGGVL 276 *************************************************5....4678899******** PP TIGR00033 278 GGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladalle 346 GGi++G+di+v+ a+Kp+++i p++++d++++ + +t+gRhDpcv +ra+p++Ea++alvl+d++l+ lcl|NCBI__GCF_000204645.1:WP_013518766.1 277 GGISTGQDIEVQLAIKPTSSIISPRESIDVHGRSTEVVTRGRHDPCVGIRAAPIAEALLALVLMDHALR 345 ********************************************************************* PP TIGR00033 347 kras 350 +ra+ lcl|NCBI__GCF_000204645.1:WP_013518766.1 346 QRAQ 349 9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.95 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory