Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate WP_013519098.1 ALIDE2_RS12280 succinyl-diaminopimelate desuccinylase
Query= SwissProt::Q9JYL2 (381 letters) >NCBI__GCF_000204645.1:WP_013519098.1 Length = 392 Score = 452 bits (1163), Expect = e-132 Identities = 227/384 (59%), Positives = 275/384 (71%), Gaps = 12/384 (3%) Query: 6 SLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTK----NIWLRRGTKAP 61 +L L ++LI+RPSVTP+D C LLAERL +GFA E L G + N+W +R Sbjct: 5 TLLLTEQLIARPSVTPEDAGCLDLLAERLAPLGFACERLDSGPSSFRVCNLWAKRAATPT 64 Query: 62 --------VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTAC 113 V FAGHTDVVPTGPVE+W S PF P +RDGRLYGRGA+DMKTSIA FV A Sbjct: 65 SQSQAAIKTVVFAGHTDVVPTGPVEQWSSAPFTPTQRDGRLYGRGASDMKTSIAAFVVAV 124 Query: 114 ERFVAKHPNHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGD 173 E F+A P +IA L+TSDEEG ++DGT VV+ L+AR E +D+CIVGEPT+V GD Sbjct: 125 EEFLAATPAPAIAIAFLLTSDEEGPSVDGTKVVVEQLRARGERLDWCIVGEPTSVQSTGD 184 Query: 174 MIKNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSF 233 MIKNGRRG+LSG LTV+G QGHIAYPHLA NP+H PAL EL VWD GN++FPPTS+ Sbjct: 185 MIKNGRRGTLSGRLTVRGVQGHIAYPHLARNPIHQAVPALAELAATVWDRGNDFFPPTSW 244 Query: 234 QISNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQ 293 Q+SNI+GGTGATNVIPGE+ + FNFRF TEST LK+RVHA+LD HG++YDL W+ GQ Sbjct: 245 QMSNIHGGTGATNVIPGEVAIDFNFRFCTESTAESLKERVHAVLDHHGLEYDLAWTLGGQ 304 Query: 294 PFLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQIN 353 PFLT G+L + AI G+ ELSTTGGTSDGRFI I +++ELGP N +IH+I+ Sbjct: 305 PFLTTPGELVGAVQQAIHAETGLTTELSTTGGTSDGRFIAQICPQVVELGPPNDSIHKID 364 Query: 354 ENVRLNDIPKLSAVYEGILARLLA 377 EN+RL DI L +Y L L A Sbjct: 365 ENIRLTDIEPLKNIYRRTLENLNA 388 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 392 Length adjustment: 30 Effective length of query: 351 Effective length of database: 362 Effective search space: 127062 Effective search space used: 127062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_013519098.1 ALIDE2_RS12280 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.14864.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-155 503.2 0.0 2.5e-155 503.0 0.0 1.0 1 lcl|NCBI__GCF_000204645.1:WP_013519098.1 ALIDE2_RS12280 succinyl-diaminop Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000204645.1:WP_013519098.1 ALIDE2_RS12280 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 503.0 0.0 2.5e-155 2.5e-155 4 370 .] 8 386 .. 5 386 .. 0.97 Alignments for each domain: == domain 1 score: 503.0 bits; conditional E-value: 2.5e-155 TIGR01246 4 lakeLisrksvtPndagaqeliaerLkklgfeieilefe....dtknlwatrgt........eepvlvf 60 l+++Li r+svtP+dag+++l+aerL lgf++e+l + + nlwa+r +++vf lcl|NCBI__GCF_000204645.1:WP_013519098.1 8 LTEQLIARPSVTPEDAGCLDLLAERLAPLGFACERLDSGpssfRVCNLWAKRAAtptsqsqaAIKTVVF 76 7889********************************9983322467*****9988988876656799** PP TIGR01246 61 aGhtDvvPaGelekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsD 129 aGhtDvvP+G++e+Wss pf+p++rdG+lygrGa Dmk+s+aafvva+e+f+++ + +++l+tsD lcl|NCBI__GCF_000204645.1:WP_013519098.1 77 AGHTDVVPTGPVEQWSSAPFTPTQRDGRLYGRGASDMKTSIAAFVVAVEEFLAATPAPAIAIAFLLTSD 145 ********************************************************************* PP TIGR01246 130 eegeaidGtkkvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkae 198 eeg ++dGtk vve l++r e +d+++vgeP+sv++ GD+ik+GrrG ++g+l+++G+qGh+aYPh+a+ lcl|NCBI__GCF_000204645.1:WP_013519098.1 146 EEGPSVDGTKVVVEQLRARGERLDWCIVGEPTSVQSTGDMIKNGRRGTLSGRLTVRGVQGHIAYPHLAR 214 ********************************************************************* PP TIGR01246 199 nPvhkavpvlkeliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelksk 267 nP+h+avp+l+el+a+ +D Gn+ffpp+s q++ni++gtga+nviPge+++ fn+rf++e+++e+lk++ lcl|NCBI__GCF_000204645.1:WP_013519098.1 215 NPIHQAVPALAELAATVWDRGNDFFPPTSWQMSNIHGGTGATNVIPGEVAIDFNFRFCTESTAESLKER 283 ********************************************************************* PP TIGR01246 268 vekildkhkldYelewklsgepfltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevve 336 v+++ld+h+l+Y+l w+l g+pflt g+l+ +v++ai+ ++ ++elst+GGtsD+rfia++ +vve lcl|NCBI__GCF_000204645.1:WP_013519098.1 284 VHAVLDHHGLEYDLAWTLGGQPFLTTPGELVGAVQQAIHAETGLTTELSTTGGTSDGRFIAQICPQVVE 352 ********************************************************************* PP TIGR01246 337 lGlvndtihkvneavkiedleklsevyeklleel 370 lG+ nd+ihk++e++++ d+e l+++y+++le+l lcl|NCBI__GCF_000204645.1:WP_013519098.1 353 LGPPNDSIHKIDENIRLTDIEPLKNIYRRTLENL 386 *******************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (392 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.65 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory