Align Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 (characterized)
to candidate WP_013536835.1 THEAM_RS00380 imidazole glycerol phosphate synthase subunit HisF
Query= SwissProt::Q7SIB9 (252 letters) >NCBI__GCF_000185805.1:WP_013536835.1 Length = 252 Score = 323 bits (827), Expect = 3e-93 Identities = 171/256 (66%), Positives = 204/256 (79%), Gaps = 12/256 (4%) Query: 3 LAKRIVPCLDVHAGRVVKGVNFVNLRDAGDPVEAARAYDEAGADELVFLDISATHEERAI 62 LAKRI+PCLDV GRVVKGVNFVNL DAGDPVE A+ YDE GADELVFLDI+A++E+RAI Sbjct: 2 LAKRIIPCLDVKDGRVVKGVNFVNLIDAGDPVENAKVYDEQGADELVFLDITASYEKRAI 61 Query: 63 LLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVRRPELIRELADHFG 122 +LDVV R AE+VF+PLTVGGGVR++ED R LL +GADKVS+N+AAV+ P+LI E A FG Sbjct: 62 MLDVVKRTAEQVFMPLTVGGGVRTVEDIRNLLNAGADKVSINTAAVKNPQLITEGAKLFG 121 Query: 123 AQAVVLAIDA------RWRGDFPEVHVAGGRVPTGLHAVEWAVKGVELGAGEILLTSMDR 176 +Q +V+AIDA +W EV + GGR PTG+ AV+WA + V+ GAGEILLTSMDR Sbjct: 122 SQCIVVAIDAKRVAPGKW-----EVFIHGGRTPTGIDAVKWAKEVVDRGAGEILLTSMDR 176 Query: 177 DGTKEGYDLRLTRMVAEAVGVPVIASGGAGRMEHFLEAFQAG-AEAALAASVFHFGEIPI 235 DGTK GYD+ LTR ++EAV VPVIASGGAG+ EHF E G A+A LAASVFHF EI I Sbjct: 177 DGTKAGYDIELTRAISEAVSVPVIASGGAGKKEHFYEGLVEGKADAVLAASVFHFKEISI 236 Query: 236 PKLKRYLAEKGVHVRL 251 P+LK YL E+GV VR+ Sbjct: 237 PELKAYLKERGVWVRV 252 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 252 Length adjustment: 24 Effective length of query: 228 Effective length of database: 228 Effective search space: 51984 Effective search space used: 51984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
Align candidate WP_013536835.1 THEAM_RS00380 (imidazole glycerol phosphate synthase subunit HisF)
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00735.hmm # target sequence database: /tmp/gapView.1479.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00735 [M=254] Accession: TIGR00735 Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-127 408.9 1.9 4.1e-127 408.7 1.9 1.0 1 lcl|NCBI__GCF_000185805.1:WP_013536835.1 THEAM_RS00380 imidazole glycerol Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000185805.1:WP_013536835.1 THEAM_RS00380 imidazole glycerol phosphate synthase subunit HisF # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 408.7 1.9 4.1e-127 4.1e-127 1 254 [] 1 251 [. 1 251 [. 0.99 Alignments for each domain: == domain 1 score: 408.7 bits; conditional E-value: 4.1e-127 TIGR00735 1 mlakriipCLdvkdgrvvkGvqfknlrdaGdpvelakkydeeGadelvflditassekretmlevverv 69 mlakriipCLdvkdgrvvkGv+f nl daGdpve ak+yde+Gadelvflditas ekr++ml+vv+r+ lcl|NCBI__GCF_000185805.1:WP_013536835.1 1 MLAKRIIPCLDVKDGRVVKGVNFVNLIDAGDPVENAKVYDEQGADELVFLDITASYEKRAIMLDVVKRT 69 8******************************************************************** PP TIGR00735 70 aekvfiPltvgGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakreaene 138 ae+vf+PltvgGG++++ed+++ll+aGadkvsintaavk+p+li+e a+ fGsq+ivvaidakr+a lcl|NCBI__GCF_000185805.1:WP_013536835.1 70 AEQVFMPLTVGGGVRTVEDIRNLLNAGADKVSINTAAVKNPQLITEGAKLFGSQCIVVAIDAKRVAP-- 136 ****************************************************************997.. PP TIGR00735 139 eakyevtikgGrestdldvvewakeveelGaGeilltsmdkdGtksGydlellkkvkeavkiPviasgG 207 +k+ev i+gGr+ t++d+v+wakev ++GaGeilltsmd+dGtk+Gyd+el+++++eav++PviasgG lcl|NCBI__GCF_000185805.1:WP_013536835.1 137 -GKWEVFIHGGRTPTGIDAVKWAKEVVDRGAGEILLTSMDRDGTKAGYDIELTRAISEAVSVPVIASGG 204 .69****************************************************************** PP TIGR00735 208 aGkaehleeaflkgkadaaLaasvfhkreltieevkeylaergvkvr 254 aGk+eh++e++++gkada+Laasvfh++e++i e+k+yl+ergv vr lcl|NCBI__GCF_000185805.1:WP_013536835.1 205 AGKKEHFYEGLVEGKADAVLAASVFHFKEISIPELKAYLKERGVWVR 251 ********************************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (254 nodes) Target sequences: 1 (252 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 4.46 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory