Align 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (characterized)
to candidate WP_013537107.1 THEAM_RS01805 3-isopropylmalate dehydrogenase
Query= BRENDA::Q9SA14 (404 letters) >NCBI__GCF_000185805.1:WP_013537107.1 Length = 359 Score = 390 bits (1001), Expect = e-113 Identities = 200/357 (56%), Positives = 254/357 (71%), Gaps = 2/357 (0%) Query: 42 KRYNITLLPGDGIGPEVISVAKNVLQKAGFLQGLEFDFQEMPFGGAALDLVGVPLPEETS 101 +++ I +LPGDGIGPE++ A V++ A G + GGAA+D GVP PEET Sbjct: 2 RKFKIAVLPGDGIGPEIVKQAVKVMEAAAEKFGFGLELNYGLIGGAAIDETGVPFPEETK 61 Query: 102 TAAKQSDAILLGAIGGYKWDKNEKHLRPEMGLLNIRRDLNVFANLRPATVLPQLVDASTL 161 SDA+LLGA+GG KWD +RPE LL +R+ LN FANLRPA + +L+DASTL Sbjct: 62 ELILSSDAVLLGAVGGPKWDNLPFEIRPERALLGMRKLLNAFANLRPARLYDELIDASTL 121 Query: 162 KKEVAQGVDMMIVRELTGGIYFGEPRGITINENGEEVGFNTEIYAAHEIDRIARVAFETA 221 K EV +GVD+M++RELT GIYFG P+GI + + E VG NT Y HE++RIA+VAFE A Sbjct: 122 KPEVVRGVDIMVIRELTSGIYFGIPKGIFV-DGDERVGINTLRYYEHEVERIAKVAFEVA 180 Query: 222 RKRRGKLCSVDKANVLDASILWRKRVTALASEYPDVELSHMYVDNAAMQLVRDPKQFDTI 281 RKR K+ SVDKANVL+A++LWR+ V + YPDVEL HMYVDNAAMQ++R PKQFD I Sbjct: 181 RKRNKKVTSVDKANVLEATVLWREVVERVHENYPDVELQHMYVDNAAMQIIRWPKQFDVI 240 Query: 282 VTNNIFGDILSDEASMITGSIGMLPSASLGESGPGLFEPIHGSAPDIAGQDKANPLATIL 341 VT N+FGDILSD +M+TGS+GMLPSAS+G GL+EPIHGSAPDIAGQ+ ANP+ATI Sbjct: 241 VTTNMFGDILSDACAMLTGSLGMLPSASIG-GKIGLYEPIHGSAPDIAGQNIANPIATIN 299 Query: 342 SAAMLLKYGLGEEKAAKMIEDAVVDALNKGFRTGDIYSPGNKLVGCKEMGEEVLKSV 398 SA M+ Y + + I+ AV L KG+RT DIYS G KLV +EMG+ + + + Sbjct: 300 SAGMMFTYSFDMPEVEEAIDKAVRAVLAKGYRTRDIYSEGTKLVSTEEMGDLIAEEL 356 Lambda K H 0.317 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 359 Length adjustment: 30 Effective length of query: 374 Effective length of database: 329 Effective search space: 123046 Effective search space used: 123046 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_013537107.1 THEAM_RS01805 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.7206.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-162 525.7 0.0 3e-162 525.5 0.0 1.0 1 lcl|NCBI__GCF_000185805.1:WP_013537107.1 THEAM_RS01805 3-isopropylmalate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000185805.1:WP_013537107.1 THEAM_RS01805 3-isopropylmalate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 525.5 0.0 3e-162 3e-162 1 348 [. 5 351 .. 5 352 .. 0.99 Alignments for each domain: == domain 1 score: 525.5 bits; conditional E-value: 3e-162 TIGR00169 1 kiavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlg 69 kiavLpGDgiGpe+v++a+kv++a +e+f++ le ++ liGGaaid+tg P+peet + ++davLlg lcl|NCBI__GCF_000185805.1:WP_013537107.1 5 KIAVLPGDGIGPEIVKQAVKVMEAAAEKFGFGLELNYGLIGGAAIDETGVPFPEETKELILSSDAVLLG 73 79******************************************************************* PP TIGR00169 70 avGGpkWdnlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvreLtgGiY 138 avGGpkWdnlp ++rPe++LL +rk l+ fanLrPa+l+++L+++s+lk+e+v+gvD++v+reLt+GiY lcl|NCBI__GCF_000185805.1:WP_013537107.1 74 AVGGPKWDNLPFEIRPERALLGMRKLLNAFANLRPARLYDELIDASTLKPEVVRGVDIMVIRELTSGIY 142 ********************************************************************* PP TIGR00169 139 fGepkereeaeeekkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeiak 207 fG pk+++ +++e+ +++t +Y+++e+eria+vafe+arkr+kkvtsvDkanvLe++ lWr++ve +++ lcl|NCBI__GCF_000185805.1:WP_013537107.1 143 FGIPKGIFVDGDERVGINTLRYYEHEVERIAKVAFEVARKRNKKVTSVDKANVLEATVLWREVVERVHE 211 ********************************************************************* PP TIGR00169 208 eyPdvelehlyiDnaamqLvksPeqldvvvtsnlfGDilsDeasvitGslGlLPsaslsskglalfepv 276 +yPdvel+h+y+Dnaamq+++ P+q+dv+vt n+fGDilsD ++++tGslG+LPsas++ + +l+ep+ lcl|NCBI__GCF_000185805.1:WP_013537107.1 212 NYPDVELQHMYVDNAAMQIIRWPKQFDVIVTTNMFGDILSDACAMLTGSLGMLPSASIG-GKIGLYEPI 279 ***********************************************************.6789***** PP TIGR00169 277 hgsapdiagkgianpiaailsaalllryslnleeaaeaieaavkkvleegkrtedlaseattavstkev 345 hgsapdiag++ianpia+i sa ++ ys++++e +eai++av+ vl++g+rt+d++se+t+ vst+e+ lcl|NCBI__GCF_000185805.1:WP_013537107.1 280 HGSAPDIAGQNIANPIATINSAGMMFTYSFDMPEVEEAIDKAVRAVLAKGYRTRDIYSEGTKLVSTEEM 348 ********************************************************************* PP TIGR00169 346 eee 348 ++ lcl|NCBI__GCF_000185805.1:WP_013537107.1 349 GDL 351 986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 12.09 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory