Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate WP_013537251.1 THEAM_RS02535 acetylglutamate kinase
Query= BRENDA::Q9HTN2 (301 letters) >NCBI__GCF_000185805.1:WP_013537251.1 Length = 292 Score = 348 bits (894), Expect = e-101 Identities = 172/281 (61%), Positives = 222/281 (79%) Query: 15 LSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQIGD 74 L EALPYIR F GKT+VIKYGGNAM +EELK FA+DV L+K VGINPV+VHGGGPQIG+ Sbjct: 11 LLEALPYIREFYGKTVVIKYGGNAMVNEELKEAFAQDVALLKYVGINPVIVHGGGPQIGE 70 Query: 75 LLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELI 134 LLKRL+IE+ F+ GMRVTD TM+VVEMVL G+VNK+IV LIN HGG+A+GL+GKD LI Sbjct: 71 LLKRLNIETRFVGGMRVTDRETMNVVEMVLVGKVNKEIVKLINSHGGNAVGLSGKDGNLI 130 Query: 135 RAKKLTVTRQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESY 194 A+K+ E+ PEIID+G VG V VN ++ L++ FIPVIAP+G+G + E+Y Sbjct: 131 VAEKIDSREYLSELKAPEIIDLGFVGRVKRVNPDIVTKLLESKFIPVIAPVGIGEDFEAY 190 Query: 195 NINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLP 254 NINADLVAG++A ALKAEKL++LT++ G+ DK+G++L L +Q+ +LIADGT+ GGM+P Sbjct: 191 NINADLVAGEMAAALKAEKLIMLTDVEGIKDKEGRLLKSLRRDQLPQLIADGTVSGGMIP 250 Query: 255 KIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLI 295 K++ A+ GGV AHIIDGRV +++LLE+FT G+GT I Sbjct: 251 KVKACEAALMGGVKKAHIIDGRVKHSILLEMFTQEGIGTEI 291 Lambda K H 0.318 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 292 Length adjustment: 26 Effective length of query: 275 Effective length of database: 266 Effective search space: 73150 Effective search space used: 73150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_013537251.1 THEAM_RS02535 (acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00761.hmm # target sequence database: /tmp/gapView.29561.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00761 [M=231] Accession: TIGR00761 Description: argB: acetylglutamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-87 276.3 4.9 1.2e-86 276.0 4.9 1.1 1 lcl|NCBI__GCF_000185805.1:WP_013537251.1 THEAM_RS02535 acetylglutamate ki Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000185805.1:WP_013537251.1 THEAM_RS02535 acetylglutamate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 276.0 4.9 1.2e-86 1.2e-86 1 231 [] 25 268 .. 25 268 .. 0.99 Alignments for each domain: == domain 1 score: 276.0 bits; conditional E-value: 1.2e-86 TIGR00761 1 tiViKiGGaais..elleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglRvTdketl 67 t+ViK+GG+a+ el+e++a+d+a l+ +gi++vivHGGgp+i ell++l+ie++fv+g+RvTd+et+ lcl|NCBI__GCF_000185805.1:WP_013537251.1 25 TVVIKYGGNAMVneELKEAFAQDVALLKYVGINPVIVHGGGPQIGELLKRLNIETRFVGGMRVTDRETM 93 69*********9899****************************************************** PP TIGR00761 68 evvemvligkvnkelvallekhgikavGltgkDgqlltaekldke............dlgyvGeikkvn 124 +vvemvl+gkvnke+v+l++ hg +avGl+gkDg+l++aek+d++ dlg+vG++k+vn lcl|NCBI__GCF_000185805.1:WP_013537251.1 94 NVVEMVLVGKVNKEIVKLINSHGGNAVGLSGKDGNLIVAEKIDSReylselkapeiiDLGFVGRVKRVN 162 *******************************************999*********************** PP TIGR00761 125 kelleallkagiipviaslaldeegqllNvnaDtaAaelAaaleAekLvlLtdvaGilegdkkslisel 193 ++++ +ll++ +ipvia++++ e+ +++N+naD +A+e+Aaal+AekL++Ltdv+Gi ++ + +l+++l lcl|NCBI__GCF_000185805.1:WP_013537251.1 163 PDIVTKLLESKFIPVIAPVGIGEDFEAYNINADLVAGEMAAALKAEKLIMLTDVEGIKDK-EGRLLKSL 230 ***********************************************************9.666***** PP TIGR00761 194 eleeieqlikqavikgGmipKveaalealesgvkkvvi 231 + +++ qli + + gGmipKv+a+ +al +gvkk++i lcl|NCBI__GCF_000185805.1:WP_013537251.1 231 RRDQLPQLIADGTVSGGMIPKVKACEAALMGGVKKAHI 268 ************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.21 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory