Align 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 (characterized)
to candidate WP_013537267.1 THEAM_RS02610 type I 3-dehydroquinate dehydratase
Query= SwissProt::O66440 (219 letters) >NCBI__GCF_000185805.1:WP_013537267.1 Length = 249 Score = 134 bits (336), Expect = 2e-36 Identities = 81/221 (36%), Positives = 120/221 (54%), Gaps = 7/221 (3%) Query: 3 IAVPLDDTNFSENLKKAKEKGADIVELRVDQFSDTSLNYVKEKLEEVHSQGLKTILTIRS 62 + V L+ N ENL++A+ D+VE R+D + V+E L+ V G + T+R Sbjct: 14 VIVALNGKNLKENLERARRLRIDLVEARLDLLEEVKPETVREFLDTVADYGFYAVTTLRP 73 Query: 63 PEEGGREVKNREELFEELS-----PLSDYTDIELSSRGLLVKLYNITKEAGKKLIISYHN 117 EGGR + EE + L P + D+EL S+ L + ITKEAGKKLI+SYH+ Sbjct: 74 VWEGGRFEGSEEERLKLLELAVNHPATAAVDVELRSK-LTEPVRQITKEAGKKLIVSYHD 132 Query: 118 FELTPPNWIIREVLREGYR-YGGIPKIAVKANSYEDVARLLCISRQVEGEKILISMGDYG 176 FE TP I E+ + + I K+A ++ D AR+ C + + K+ + MG+ G Sbjct: 133 FEKTPREEEIEELFKACLKKQADIVKLAFAGKTHADAARVCCTLSKFKEPKVFMVMGEAG 192 Query: 177 KISRLAGYVFGSVITYCSLEKAFAPGQIPLEEMVELRKKFY 217 K +R+ G+ FGS++TY + APGQI EE+V L FY Sbjct: 193 KFTRVVGFSFGSLLTYTFFGRPVAPGQIEAEELVRLISDFY 233 Lambda K H 0.317 0.137 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 249 Length adjustment: 23 Effective length of query: 196 Effective length of database: 226 Effective search space: 44296 Effective search space used: 44296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate WP_013537267.1 THEAM_RS02610 (type I 3-dehydroquinate dehydratase)
to HMM TIGR01093 (aroD: 3-dehydroquinate dehydratase, type I (EC 4.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01093.hmm # target sequence database: /tmp/gapView.5916.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01093 [M=229] Accession: TIGR01093 Description: aroD: 3-dehydroquinate dehydratase, type I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-52 164.9 0.0 1.8e-52 164.7 0.0 1.0 1 lcl|NCBI__GCF_000185805.1:WP_013537267.1 THEAM_RS02610 type I 3-dehydroqu Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000185805.1:WP_013537267.1 THEAM_RS02610 type I 3-dehydroquinate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 164.7 0.0 1.8e-52 1.8e-52 2 228 .. 14 228 .. 13 229 .. 0.92 Alignments for each domain: == domain 1 score: 164.7 bits; conditional E-value: 1.8e-52 TIGR01093 2 ilvpltakdleealeelekikevgaDivElRvDllkdvsseksveavaeqlsellkdlplilTiRtqke 70 ++v l+ k+l+e+le ++ + D+vE R+Dll++v+ e v ++ +++ + + T+R +e lcl|NCBI__GCF_000185805.1:WP_013537267.1 14 VIVALNGKNLKENLERARRLR---IDLVEARLDLLEEVKPET-VREFLDTV--ADYGFYAVTTLRPVWE 76 678999999999999999966...9****************6.66666666..23677889******** PP TIGR01093 71 GGkfkgdeeerleelkeaieknlvdlvDiElkleeeavkelikeakkaktkiilSnHdfektpskeelv 139 GG+f+g+eeerl++l+ a+++++ vD+El+++ + + + + +k+a++k+i+S+Hdfektp +ee++ lcl|NCBI__GCF_000185805.1:WP_013537267.1 77 GGRFEGSEEERLKLLELAVNHPATAAVDVELRSKLT--EPVRQITKEAGKKLIVSYHDFEKTPREEEIE 143 *******************************99876..44666679*********************** PP TIGR01093 140 erlekaqsldaDivKiavmaksieDvltLleitlkveeekdkplialsMgekGkisRvlgavlgsvltf 208 e+++ + +aDivK+a +k D +++ + + k + p + ++Mge Gk++Rv+g +gs lt+ lcl|NCBI__GCF_000185805.1:WP_013537267.1 144 ELFKACLKKQADIVKLAFAGKTHADAARVCCTLSKFK----EPKVFMVMGEAGKFTRVVGFSFGSLLTY 208 *********************************9998....9*************************** PP TIGR01093 209 gslgkasAPGQisvkelrel 228 g APGQi+ +el +l lcl|NCBI__GCF_000185805.1:WP_013537267.1 209 TFFGRPVAPGQIEAEELVRL 228 ***************99865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (229 nodes) Target sequences: 1 (249 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.31 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory