Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_013537316.1 THEAM_RS02845 aminotransferase class I and II
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_000185805.1:WP_013537316.1 Length = 369 Score = 166 bits (419), Expect = 1e-45 Identities = 114/367 (31%), Positives = 185/367 (50%), Gaps = 25/367 (6%) Query: 17 IRKFSNLVAQHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTSYTPNAGYLELRQAVQL 76 + + L + +VI L IG+PD P VK A + + E YTP G +L++A+ Sbjct: 15 LERAKELEKRGREVIHLEIGEPDLPVPERVKRKAAELLTETELKYTPATGIPKLKEAIAE 74 Query: 77 YMKKKADFNYDAESEIIITTGASQAIDAAFRTILSPGDEVIMPGPIYPGYEPIINLCGAK 136 + + + E ++++T G+S + AA +T+ E+ P YP Y+ I+ + G + Sbjct: 75 FYYSRYRVVVEPE-QVVVTPGSSPGLVAALKTVSRLVGEISFTDPGYPCYKNILKVLGEE 133 Query: 137 PVIVDT-TSHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSIAALLKGRNV 195 V + + FK+ + NT +++ P+NP+G ++ EL+ ++ + Sbjct: 134 GVALPVGPENSFKVRPFQV------NTPALIVNSPANPSGAVYTKRELEKLS-----KRA 182 Query: 196 FVLSDEIYSELTYDRPHYSIATYLRDQTIVINGLSKSHSMTGWRIGFLFAPKDIAKHILK 255 F++SDEIY LTY S R+ IV+NG SK MTGWR+G+L A D+ + I Sbjct: 183 FLISDEIYHGLTYGEEAPSALEVTRN-CIVVNGFSKFFLMTGWRVGWLIASPDMVEPINA 241 Query: 256 VHQYNVSCASSISQKAALEAVTNGFDDALIMREQ-----YKKRLDYVYDRLVSMGLDV-V 309 + Q V ++SQ AA+E F + ++ Q ++KR + + + L +G V V Sbjct: 242 ILQNTVIAPPTLSQLAAVEC----FSEEVLSELQENVKVFRKRKEILLNGLKEIGFKVPV 297 Query: 310 KPSGAFYIFPSIKSFGMTSFDFSMALLEDAGVALVPGSSFSTYG-EGYVRLSFACSMDTL 368 +P GAFYI+ F SF F+ LLE VA+ PG F G E +VR SF + + Sbjct: 298 EPKGAFYIWADASPFTEDSFKFAFELLERTSVAVTPGRDFGYNGTEKFVRFSFCTETEKI 357 Query: 369 REGLDRL 375 E L+RL Sbjct: 358 LEALERL 364 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 18 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 369 Length adjustment: 30 Effective length of query: 363 Effective length of database: 339 Effective search space: 123057 Effective search space used: 123057 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory