Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate WP_013553363.1 NITSA_RS02030 acetylglutamate kinase
Query= curated2:A9A1K7 (267 letters) >NCBI__GCF_000186245.1:WP_013553363.1 Length = 283 Score = 130 bits (327), Expect = 3e-35 Identities = 88/261 (33%), Positives = 143/261 (54%), Gaps = 27/261 (10%) Query: 1 MITIKIGGSVVD--DLHPSTIADIKKIAESEGV--ILVHGGGKEVTKVCEQLGKEPKFVT 56 +I IK GGS + +L DI + + G+ ++VHGGGK +T++ LG + +F+ Sbjct: 25 IIVIKYGGSAQESEELKAKFAQDIV-LLHTVGMRPVVVHGGGKNITRLLSDLGVDTRFID 83 Query: 57 SPSGIKSRYTDKETAEIFTMVMSGRINKTIVQMLQKNGINAIGLSGVDAKVIEADRKKKL 116 R T +E + MV+SG INK IV +L G A+G+SG DA +EA Sbjct: 84 G-----QRVTTREVMRVAEMVLSGEINKEIVALLNSQGARAVGISGKDANFLEAI----- 133 Query: 117 LIVNEKGRKQAIDGGYTGKIREVNASFIKSLLDQGLTPVISPIAISEE--SEFLNVDGDR 174 K + + GYTG I ++N + ++LD G PVI+PIA S+ N++ D Sbjct: 134 -------PKDSENFGYTGVIEQINTEIVDNILDDGFVPVIAPIAGSQTLGHPGFNINADL 186 Query: 175 AAAYVAGKVGSDKVLFITNVDGLL-MDDKVVPKLTLAEAKEIRPK--IGPGMEKKILAST 231 AA+ +A +G+ K+LF+T+ G+L + K++P LT+ + + ++ + I GM K+ A Sbjct: 187 AASRIAVALGARKILFLTDTPGVLDGEGKLIPTLTIDQTRRLKEEEVIRGGMIPKVDACI 246 Query: 232 EALDMGVTTALIANGQKENPI 252 +AL GV A I +G+ E+ + Sbjct: 247 DALRGGVKKAHIIDGRVEHSL 267 Lambda K H 0.313 0.133 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 283 Length adjustment: 25 Effective length of query: 242 Effective length of database: 258 Effective search space: 62436 Effective search space used: 62436 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory