Align IGP synthase, amidotransferase subunit (EC 4.3.2.10) (characterized)
to candidate WP_013554617.1 NITSA_RS08545 imidazole glycerol phosphate synthase subunit HisH
Query= reanno::HerbieS:HSERO_RS20325 (212 letters) >NCBI__GCF_000186245.1:WP_013554617.1 Length = 217 Score = 161 bits (408), Expect = 7e-45 Identities = 96/220 (43%), Positives = 130/220 (59%), Gaps = 23/220 (10%) Query: 4 IVVVDYGMGNLRSVAQALRHVAPEADVRISGEVADIRAADRVVLPGQGAMPDCMRSLRES 63 I V+DY MGNL SV A V A+ + + ++ DR+ LPG GA PD M LR + Sbjct: 2 IGVIDYKMGNLGSVLNAFAKVGARAE--LVSDPKHLKKYDRIQLPGVGAFPDAMEHLRST 59 Query: 64 GVQDAVIEASRT-KPLFGVCVGEQMLFDWSEE-GDTPGLGLLPGKVVRFDLEGMRQDDGS 121 G+ +A+ E +R+ KPL G C+G Q+LF+ SEE G GLGL+PG+VVRFD D + Sbjct: 60 GMDEAIREFARSGKPLMGTCLGMQLLFEESEEFGKHQGLGLIPGRVVRFDESKF---DHT 116 Query: 122 LFKVPQMGWNHVH--------------QTSRHPLWEGIADNAFFYFVHSYYAVPAESAHV 167 L KVP MGWN + + R L+EG+ D + YFVHSY+AV + + Sbjct: 117 L-KVPHMGWNELFVQRTKGGEDKRWKSEDGRSTLFEGLPDEFYLYFVHSYHAV-CDDEYA 174 Query: 168 VGQTPYGRDFACAVARDNIFATQFHPEKSASAGLQLYRNF 207 +G+T YG +F AV R+NIF Q HPEKS GL++ +NF Sbjct: 175 IGKTYYGYEFVSAVQRENIFGIQPHPEKSHDNGLKIVKNF 214 Lambda K H 0.322 0.137 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 8 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 217 Length adjustment: 22 Effective length of query: 190 Effective length of database: 195 Effective search space: 37050 Effective search space used: 37050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate WP_013554617.1 NITSA_RS08545 (imidazole glycerol phosphate synthase subunit HisH)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01855.hmm # target sequence database: /tmp/gapView.17559.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01855 [M=198] Accession: TIGR01855 Description: IMP_synth_hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-70 223.3 0.1 1.1e-69 220.3 0.1 1.9 1 lcl|NCBI__GCF_000186245.1:WP_013554617.1 NITSA_RS08545 imidazole glycerol Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000186245.1:WP_013554617.1 NITSA_RS08545 imidazole glycerol phosphate synthase subunit HisH # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 220.3 0.1 1.1e-69 1.1e-69 1 197 [. 2 216 .. 2 217 .] 0.92 Alignments for each domain: == domain 1 score: 220.3 bits; conditional E-value: 1.1e-69 TIGR01855 1 ivvidygvgNlksvkkalervgaesevvkdskelekadklvlPGVGafkeamkklrelelellaekvvk 69 i+vidy++gNl sv +a+ +vga++e+v+d k+l+k+d++ lPGVGaf +am++lr ++++ +++ ++ lcl|NCBI__GCF_000186245.1:WP_013554617.1 2 IGVIDYKMGNLGSVLNAFAKVGARAELVSDPKHLKKYDRIQLPGVGAFPDAMEHLRSTGMDEAIREFAR 70 79*********************************************************99999***** PP TIGR01855 70 kkkpvlgiClGmQllfekseEgkevkglglikgkvkkleaek.....kvPhiGWnevevvk........ 125 ++kp++g ClGmQllfe+seE ++++glgli+g+v++++++k kvPh+GWne+ v++ lcl|NCBI__GCF_000186245.1:WP_013554617.1 71 SGKPLMGTCLGMQLLFEESEEFGKHQGLGLIPGRVVRFDESKfdhtlKVPHMGWNELFVQRtkggedkr 139 **************************************999889999*********9987633333333 PP TIGR01855 126 ......esellkgleeearvYfvHsYaveleeeeavlakadygekfvaavekdnivgvQFHPEkSgktG 188 s+l++gl +e ++YfvHsY++++ + e+++ k+ yg +fv+av+++ni+g+Q HPEkS+++G lcl|NCBI__GCF_000186245.1:WP_013554617.1 140 wksedgRSTLFEGLPDEFYLYFVHSYHAVCDD-EYAIGKTYYGYEFVSAVQRENIFGIQPHPEKSHDNG 207 333222368*********************98.8*********************************** PP TIGR01855 189 lkllknfle 197 lk++knf++ lcl|NCBI__GCF_000186245.1:WP_013554617.1 208 LKIVKNFTK 216 *******86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (198 nodes) Target sequences: 1 (217 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.03 # Mc/sec: 1.36 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory