Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate WP_013554809.1 NITSA_RS09475 anthranilate phosphoribosyltransferase
Query= SwissProt::P83827 (329 letters) >NCBI__GCF_000186245.1:WP_013554809.1 Length = 326 Score = 238 bits (608), Expect = 1e-67 Identities = 141/309 (45%), Positives = 190/309 (61%), Gaps = 9/309 (2%) Query: 25 LMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAMREAARPLRVH---RRPLLDIVGTGG 81 L A E+S A LVAL +GE P EIAA A MR + L V R+ L+D+VGTGG Sbjct: 12 LFANEMSEEEARDFLVALYEKGESPEEIAAAAEVMRAHSVKLPVPEDLRQKLIDVVGTGG 71 Query: 82 DGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSADLLEALGVDLEAPPERVGEAIE 141 D G N+ST AL+ AA G VAKHGNR+ +S++GSAD+L+ALG+ L+ PE+ +E Sbjct: 72 DKSGSFNISTTVALLLAASGSYVAKHGNRSITSKSGSADVLDALGMRLDLSPEQQVMMLE 131 Query: 142 ELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLTNPAGADAYVLGVFSPEWLAPM 201 E GF F+FA HPAM+H+ P+R L RT+FN+LGPLTNPAGA Y+LGVFSP+++ P+ Sbjct: 132 ETGFTFIFAIHHHPAMKHIMPIRRSLDHRTIFNILGPLTNPAGARKYLLGVFSPDYVCPI 191 Query: 202 AEALERLGA-RGLVVHGE-GADELVLG---ENRVVEVGK-GAYALTPEEVGLKRAPLEAL 255 A+AL L R V+ E G DE+ + VE K + PE G +RAP EA+ Sbjct: 192 AKALLDLDVERAYVLSSEDGMDEISISAPTRFAYVEAEKVSEGVIEPEAHGFRRAPKEAI 251 Query: 256 KGGGPEENAALARRLLKGEEKGPLADAVALAAGAGFYAAGKTPSLKEGVALAREVLASGE 315 GG EENA + RR+L GEE+GP + V L A G+ ++E + + E + SG+ Sbjct: 252 LGGEAEENATILRRILSGEEQGPKREIVLLNGAYALSADGRVRDIQEAIEILSETIDSGK 311 Query: 316 AYLLLERYV 324 A LE+ + Sbjct: 312 AAEHLEKTI 320 Lambda K H 0.317 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 326 Length adjustment: 28 Effective length of query: 301 Effective length of database: 298 Effective search space: 89698 Effective search space used: 89698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_013554809.1 NITSA_RS09475 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.31143.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-112 362.6 0.0 1.2e-112 362.5 0.0 1.0 1 lcl|NCBI__GCF_000186245.1:WP_013554809.1 NITSA_RS09475 anthranilate phosp Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000186245.1:WP_013554809.1 NITSA_RS09475 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 362.5 0.0 1.2e-112 1.2e-112 15 329 .. 5 321 .. 1 322 [. 0.97 Alignments for each domain: == domain 1 score: 362.5 bits; conditional E-value: 1.2e-112 TIGR01245 15 aeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkveke..eseelvDivGTGGDg 81 +++ ++ ++++e+s+++ +lval kge++eeia++a+++r++++k+++ +++l+D+vGTGGD+ lcl|NCBI__GCF_000186245.1:WP_013554809.1 5 VKKEFERLFANEMSEEEARDFLVALYEKGESPEEIAAAAEVMRAHSVKLPVPedLRQKLIDVVGTGGDK 73 5677899999************************************99765423789************ PP TIGR01245 82 lktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFlfAPk 150 + ++NiST+ al++aa G vaKhGnrs++sksGsaDvL+alg++l+lspe+ +lee+g++F+fA + lcl|NCBI__GCF_000186245.1:WP_013554809.1 74 SGSFNISTTVALLLAASGSYVAKHGNRSITSKSGSADVLDALGMRLDLSPEQQVMMLEETGFTFIFAIH 142 ********************************************************************* PP TIGR01245 151 yhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhgedg 219 +hpa+k+++p+R++L rt+fN+LGPL+nPa a+ +lGv+s+d+v +a++l l v+ra v+++edg lcl|NCBI__GCF_000186245.1:WP_013554809.1 143 HHPAMKHIMPIRRSLDHRTIFNILGPLTNPAGARKYLLGVFSPDYVCPIAKALLDLDVERAYVLSSEDG 211 ********************************************************************* PP TIGR01245 220 lDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevlegkekkakrdivv 288 +DEis+ ++t+ a +++++++e ++pe g+ ra++e++ gg+aeena++l+++l+g+e+++kr+iv+ lcl|NCBI__GCF_000186245.1:WP_013554809.1 212 MDEISISAPTRFAYVEAEKVSEGVIEPEAHGFRRAPKEAILGGEAEENATILRRILSGEEQGPKREIVL 280 ********************************************************************* PP TIGR01245 289 lNaaaalyvagkakdlkegvelakeaiksgkalekleelva 329 lN a al + g+++d++e++e +e+i+sgka+e+le+ ++ lcl|NCBI__GCF_000186245.1:WP_013554809.1 281 LNGAYALSADGRVRDIQEAIEILSETIDSGKAAEHLEKTIR 321 *************************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (326 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.45 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory