Align Cystathionine beta-lyase PatB; CBL; Beta-cystathionase PatB; Cysteine lyase PatB; Cysteine-S-conjugate beta-lyase PatB; EC 4.4.1.13 (characterized)
to candidate WP_013554938.1 NITSA_RS10130 putative C-S lyase
Query= SwissProt::Q08432 (387 letters) >NCBI__GCF_000186245.1:WP_013554938.1 Length = 397 Score = 313 bits (803), Expect = 4e-90 Identities = 161/384 (41%), Positives = 237/384 (61%), Gaps = 4/384 (1%) Query: 2 NFDKREERLGTQSVKWDKTGELFGVTDALPMWVADMDFRAPEAITEALKERLDHGIFGYT 61 +F + +R GT S KWD E FGV DALP+WVAD DF AP+A+ EA+++R +H I+GY+ Sbjct: 12 DFPRYVDRRGTGSSKWDAVTERFGVADALPLWVADGDFSAPKAVQEAIRKRAEHPIYGYS 71 Query: 62 TPDQKTKDAVCGWMQNRHGWKVNPESITFSPGVVTALSMAVQAFTEPGDQVVVQPPVYTP 121 + +++ W + R GW++ E I GVV +L++A++A+TE G+ V+VQ P+Y P Sbjct: 72 EYTEGFYESIEDWYRRRFGWEIEREWIVPEHGVVLSLNLAIEAYTEVGEGVIVQTPIYPP 131 Query: 122 FYHMVEKNGRHILHNPLLEKDGAYAIDFEDLETKLSDPSVTLFILCNPHNPSGRSWSRED 181 F V + R +L NPL IDF+DLE K S+ L +LC+PHNPSGR+WS E+ Sbjct: 132 FLKAVRHHRRKLLENPLQVTPEGCRIDFDDLEAKASE--AKLLLLCSPHNPSGRAWSDEE 189 Query: 182 LLKLGELCLEHGVTVVSDEIHSDLMLYGHKHTPFASLSDDFADISVTCAAPSKTFNIAGL 241 L ++ E+ ++ + VVSDEIHSD+ +Y H P ASL + S+ APSKTFNIAGL Sbjct: 190 LERIAEIAEKYDLIVVSDEIHSDI-VYTRPHRPLASL-PGMRERSLVLHAPSKTFNIAGL 247 Query: 242 QASAIIIPDRLKRAKFSASLQRNGLGGLNAFAVTAIEAAYSKGGPWLDELITYIEKNMNE 301 S +IP+ R ++ A+ +R GL N F + A+EAAY +G WL+ ++ +N+ Sbjct: 248 NTSYALIPNDSLRRRYIAAHERAGLDNGNVFGIVALEAAYREGEAWLEAMLEIYRENIAY 307 Query: 302 AEAFLSTELPKVKMMKPDASYLIWLDFSAYGLSDAELQQRMLKKGKVILEPGTKYGPGGE 361 FL+ PK++ + +A+YLIWLD GL D LQ L++ ++ L PG +G G Sbjct: 308 VRDFLAQHTPKIRPLPVEATYLIWLDCRELGLEDEALQSFFLQEAQLALNPGISFGKEGS 367 Query: 362 GFMRLNAGCSLATLQDGLRRIKAA 385 GFMRLN S L++ + R++ A Sbjct: 368 GFMRLNVATSGENLEEAMTRLERA 391 Lambda K H 0.318 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 397 Length adjustment: 31 Effective length of query: 356 Effective length of database: 366 Effective search space: 130296 Effective search space used: 130296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory