Align ornithine cyclodeaminase (EC 4.3.1.12) (characterized)
to candidate WP_013643655.1 METBO_RS00250 alanine dehydrogenase
Query= BRENDA::Q88H32 (350 letters) >NCBI__GCF_000191585.1:WP_013643655.1 Length = 335 Score = 137 bits (346), Expect = 3e-37 Identities = 90/281 (32%), Positives = 145/281 (51%), Gaps = 13/281 (4%) Query: 53 GVIELMP--VADKSRYAFKYVNGHPANTAR-NLHTVMAFGVLADVDSGYPVLLSELTIAT 109 G + +MP + + K VN HP N + NL TVM L D SG+P+ + + T T Sbjct: 57 GDLRIMPAFIKNMDEAGVKCVNVHPENPVKYNLPTVMGIIQLFDPKSGFPLSVMDGTWIT 116 Query: 110 ALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAK 169 +RT A + + + LAR +++ + +IG G Q+ Q +A + + IE + + Sbjct: 117 NMRTGAAAGVGTKYLAREDSKTLGIIGAGKQAFTQLMALKEVMDIEHAHVFCRTCSSREN 176 Query: 170 LIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEPGMHLNAVGGDC 229 ++ + I S+ EAVK +D++ TVT A +I + + G H+NA+G D Sbjct: 177 FADMARKRFDIDINAVSTAEEAVKNMDVVVTVTP--ANKPVIKTEWITEGTHINAMGADA 234 Query: 230 PGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVV-------DLWRVLRGETEGR 282 PGK EL +L+ AR+F++ Q R GEI +P ++ + V+ G EGR Sbjct: 235 PGKQELEVGILQKARIFIDCWEQARHSGEI-NVPVHDGIITRKSISSKIGDVIIGNAEGR 293 Query: 283 QSDSQVTVFDSVGFALEDYTVLRYVLQQAEKRGMGTKIDLV 323 SD +TVFDS G A++D V ++A K+G+GT I+ + Sbjct: 294 ISDEDITVFDSTGLAVQDMVTGWKVYEEAVKKGVGTVINFL 334 Lambda K H 0.320 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 335 Length adjustment: 29 Effective length of query: 321 Effective length of database: 306 Effective search space: 98226 Effective search space used: 98226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory